ELF4 4 ((%44444488 \ HHH PtdQtd/lib/ld-linux.so.2GNUaiW@d,eL)NB>(&M/8a\K[cUVZ`Pf96H<Ig bX4EY 1A Rh3$_T;^O "!'2 #*.0=C:?7%QGSJ+F5-]DK(=H1;`Y`/u=H0A7gM"//vD7IW1{o@b*:; :Z:5/%7q:;]:CdPhW:3!B5.AQ7l*OWp_ _ h,#3L:8#q@c6:8XGH^ ;b3,b=^S#(@ t:hypuO:itG;DJ:\_ 8/t:  @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_putc_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii Bii Lii Vg`d&h'l3pTtW     ġȡ̡Сԡءܡ  !"#$ %$((),*0+4,8-<.@/D0H1L2P4T5X6\8`:d;h<l=p>t?x@|ABCEFGHIJKLMNOPQRSĢUȢV̢XТYԢZآ\ܢ]^`abdefhUS[W7[5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%ġh` %ȡhh%̡hp%Сhx%ԡh%ءh%ܡh%h%h%h%h%hp%h`%hP%h@%h0%h %h% h%h%h%h%h% h%$h %(h(%,h0%0h8p%4h@`%8hHP%<hP@%@hX0%Dh` %Hhh%Lhp%Phx%Th%Xh%\h%`h%dh%hh%lh%php%th`%xhP%|h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%Ģh` %Ȣhh%̢hp%Тhx%Ԣh%آh%ܢh%h%h%h%h%hp%h`%hP%h@1^PTRhhQVh`CUS[øt[ÐUPP=xt ҡuxÉUQQtt hfÐUh4$(ÉU hh@hXdPjQZdYPj ÍUPP PEh@Phh@Pj^v'UPPA葠UQQjRdÉUPPDpU]E&UVS5t h9J^dQh4jV:uRR`P\PC4PC$P8CuPPPhlh^h (h h{39h h{jVa: u^dNh RPPPPPPSNluPRhh^h n@PPh h{8h h{jV9 e[^]ËQRPPPPPPShh^h 0jPPPPPPPSQRFlPFhPPhp&'UPPƟ UWVS$E} EEu E' ' $ $ jjlH|$ x$ $ $ 葄\CgbB0 ]\7\( v@PPj/PuN8-usX@^HUtɋC d Sj9L= P؃u RXPXP${Eu F$EFPP_^SFYV R1ҊA% Š`C1A`CC=C1C=`CېUSQ]{t]Ë9| C]RRjP(' C]Í&USP]C~ t C]PPjP,' ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P1C1]Ít&PPjP,' C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU <EPLHP@L8<]Í'UUJLBPABPBLBPBL]Ð8UV1S=8XtC0uCLX=8ue[^]à SЃ ƋCLݍ'8UV1S=8XtC4uCLX=8ue[^]à SЃ ƋCLݍ'8UV1S=8XtC8uCLX=8ue[^]à SЃ ƋCLݍ'8UV1S=8XtC뇍&E ;]%uve[^_]ÍE9sJ'UUEutËEPE PR/ øÍvUSQQ]jnjh$@1҃lwRPShfЋ]ÐUU0 vv %&]Í&'USMȊt,pCu.t:t _t-u Au1[]É[]Í'USMȊt*pCu.t _t-uvAu1[]É[] UWVSP]TSX\1Åt^PPj:Su1t@jj jPƊ<*„ Шt7TffPfRP Se[^_]PhTSju S`tȋ@T렍&UWVSE}`WdhlDžPPj:W|1EtBCPPj-SƅFjj jSojj EjV]Ɗ<*„ ШtHdEffbE Uf`EE`0 WEe[^_]PhdWju W tNj@d돍&B'UWVS(EPǃ1txEU PPj/WKÅpPPj.VtCMSQVjtRE RPWjtB W؍e[^_]ÍvEjj PV{t UtF:tA1à W$t@U 렋UE RPWjuà wt )ȋULE>'UWVSEuEuE}uF11ҊڍB=UuE@E}}EtOFYЀ ƒ.%u3 vE.…%t8}t2GEu}~E UE)[F^_]Ív1[^_]ÍUS1ۋU t&ABHЃ v[]É'UWVSP1ɋE]߉f@f@E E9vl1C9//:%uف//:u=K&UF‰U9wE E}pttht1e[^_]Íe[^_]ËEPS'^_tӸP;:t fUfBCSY'UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPƃ1tPSWV9e[^_]ÐU jhhlp$ %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVS1M]Q]U EE)Ћ})NjS :9s}C 9v9~ME)VRURPE EPEPE PC;E vCC$;E vC$CCхu;C(r e[^_]ÉCuv'UWVS 1}U ])ЋU)‰USE 9sqC 9v9sy)PRUWPuEujC;E vUЉCC$;E v}C$sECхu;C(ru e[^_]ÉuCu{}uM PWVQo|vUWVS 1ۋu}N99r e[^_]ÉRE )QE PE PEE…%uTF;E w>F$;E vF$FFхu;F(re[^_]F뻐PEP]SM QE U D 농t&UVSEu] PEPF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EE]EWhMQJ W$RG PGPGPGXPh EP%E G9EvEEPSh@uV;]}3ރtvPD;XPhEPt2C;]|͋EEEE E e[^_]'G냋EH9tPPEPj C봍vQShURdPD;XPhEPLwEPjjh믐USD@t0tf$ EčERRPEPi蔿 ] PEPEPEPEPhhlPͿ hS]SQiZhPݿ]ÐUSD@ttf$ EčEQQPEP Uȍ] PERPEPEPhhPMESPhP[ hQ]]ÐUSQ@]ttERPE PS$(]ÍUVSuPPVP蔾tKye[^]Ít&'UVSuKxPPVPOue[^]Ít&'UWVSEE u]= Ȩ$ ;G9EPS)PRbE^);EQED Kx(EE‰EEEx2M D ÉD D D }G}1;}t&D1һfft3 G;}|1;}Dž||G;}|[|Et*f>tE|E 9D)|D)D);E }E »tt dd0gfffttKttU)ʉttw)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh$ ]\$ ‹ $ uȁ?BEU;x$ %PEhx$ P~E 9E%EU|$ x$  |$ Mb)ʉ$ ҍ)Ѝ$ x$ £$ e[^]É@B@UE;x$ 4;|$ )E9FRU ؅t1Phx$ V$ U)‹E +$ x:#$ $ EU@BBUWVSE]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhPe[^_]ÉڹQPЉ )ʋMRhQүU‹EHUE%&E.P)Rhh莯EEvڹPЉ)ʋMRhQFU‹EHUEf?ډ)UWVS}W<' 5ȴL0$\0 … ШuAf\AY C@Y ;|rA D3$WȴD' Hx4 ȴȀxu t&Jx (ʀ8t ' e[^_]ÉA됍t&'UWVS 1=Ĵ9}-1PPEP$ P[u ǃ$ F<9|Սe[^_]ÍUWV1=Ĵ19};$ tF89B8~A<9|tF8t VV$uF8te1^_] ' e^_]UĴV1S9}1$ F<9}"tS8t FSS(Ĵ<9|ލe[^]Ð&UWVS EPjjhEEE Ĵ19$ t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99$ uP$ PEhP֧$ MQj jhC$ $$ EPjjh~E@EPPEPCj 軩 Ĵ<9cv}19} tUB4uĴMPVShQe1[^_]Í&UEPjjhziRPEh PҦ'URRP' uà h ' Ѓu h ' H' 1ɉÐUSԴt'B дԴ̴HC̴дЋ]áд190~شtLJ AJ 1҅t̓ EP4x8ڋEC CECд@д뒃 RXM믡شP JP 1i&US]CPqXKQgtشP JP д]HдÍv'UUu&ԴB ̴@Դ̴дH]д]x&U jjh9 d}D8%U tV;uӋDDE;j54F54u ]WVShTPE PEPh(*Dž MQ:t&SPPRYBuU EQRPh\Dž މPP;u鋅@ L/}_@| ,PۆXPφXPÆX=$W趆^8S詆YXR蜆XhP萆X,P脆XPx_5Vk[ QT$ 4R1@~oy1iu1Cdu1C.UB8jj jP5llt9tꋽl9luփ E QRPEPh! DžE SPEPhDžqM UVVjSQRjP t DžUB8PE PEPh uPE PEPh@kM} uPWVh<uPE PEPh }1tu1Ccu1Cpu1CBAG n1ہ,UB8+M 5 UUUU}@:1au1Blu1Blu1BU(1ou1Bdu1Bdu1By( _}PE PEPh|Džx1au1Ccu1Clu1C} OQ诩t* WRPE PEPhۻDž PP0PEP3Eu ]xWVSh 蓻u]>u WVShdDž޿y % }PPju} PWVjS t DžUB8 ) DP~MXAP} DDP| uHjj j~ W| LjPNQt] RPE PEPhH3 uPE PEPhDžyPWWhP蟙t\=G俉GEp>&ƿuB@BCM8u] MVSQhY EU QRPh- 9u1^iu1Cfu1Ct8PQ0PEP)E u A]P )fuD8DžCnE}D8PPPDP% !ÉE;aUM ZUSQRhD(Dž YYQf$dtRjhLPe5}džwDž> E}D8BP PPDPג  !ÉE;azUPP} uPBPPWVhlˡ Dž@\މ}D8/ PkeXDPd  Pvc $UPP} uPBPPWVhl Džu\މ}D8 PdXDPc Pb PMVVSQRPE PEPh5 Džu } FPuPWVh DžyESS }QPRPE PWhʟ Dž?u } FPuPWVh號 Dž ,QfcMBǂ,%I@B9tuv >b jO`tRjhcPa,ǀ0jϻMMAPE PEPhH譞Dž"u U ESQRPh| DžDžauPPj} FuPWVjSZ t Dž ,Q b=UGLJ,% GB8}w > P_4$_MAZ8ts P_à S^=,ZUYB8utMPA PAPh}S,P` 0Z 떃 P\_p4$Q^,WhV,VI` 0n j^tRjhP_,ǀ0,ESSjU HEQRPjP襼 t Džt B BA A}PPj5G}PE PWjV0 t Dž ,S_Bǂ,% BJtuh P]_V]t4$\,EYP R@PhV,W^ 0 jX\tVjhcP],ǀ0suPPj=PE PEPjW t Dž}_yHMA8 XPd^uX~W] XXQv\ \jj jVRn\=``?~;E j?PEPhxǀ`?>PE PEPhL袙 EMS] 0VSQho bM\qJ=tu}G 8t4W1lu1Beu1Bnu1Bu UB8uiM E YSRPEPh 1 u}SPE PWh莘 PPjj@\áuXF Pt[ C~ WuZ Cjj jvVpZ C @jPhxCQKh k}w\S=tuUB 8t4R1lu1Beu1Bnu1Bu uF8ul} WRPE PEPhJ E u ]PR8WVSh PPjjZáXEx WYU Cr VX MCjj jIQX C @jPhCQKu} uPWVhIRRUjPE PEPjP3 t DžMA8 SYǀYRYuXFPX= PWDž Ep>tX5FFu@;u=PЃ H!ƒ t1}PE PWhlQЃ4H!ƒ4?M USQRh襔=Dž މuC5F}PE PWh 4މ&5FPE PEPh|ړ_uE VRPEPhH蹓Dž.M PRXwN9(}*u} uPWVhtً ‰ }PE PEPh!EPE PEPhDžgމG 5~~iu ]WVSh虒  UPPju :]WVSjQ] t DžMRRj:APQ} GPRtLBAB AB$A B(^EPE PEPh近Dž4u ]WVShh藑uPE PEPhDhMPPjPE PEPjP t DžuF8D} OQx~] W}RPE PWh蠐 UM USQRhqDž1lu1Cou1Cgu1CEX;t-@8u!;t uF8u%U EQRPhDž_ POÅ)}G 8U1B8pUB8/. P}…xB|BEB fDžxEfzu fDžzue xQjpPRQqu]~u WVShhюDžFu ]WVSh<謎Dž!xQjpPRhQ Pw{…t\xQjnRP"QfDžx PdDžzMAPE PEPh$Q Mu ]jkyWVShԍ DžI PƅG PE PEPh떋^M USQRh t'UWWj] 2MVSQjR' t DžMA8t A8 uPE PEPh,nj7ERRjPE PEPjP豬 t Dž erroPEh^$r neh (ar 'P,bala0nce'4{mE }h PWhi yMSShtE U QRPjP t DžuF8jj jPMERRjPE PEPjP葫 t DžUB8jj jPMtuPPhPE PEPjP/ t Dž}G8txjj jP%MZPE PEPh0辊.}PE PWh0蒊?u ]WVSh0fPE PEPh9Dž?u ]WVShDžk?^uF8tvSSPdP7s3EU QRPh虉 މuD5^^}PE PWh4B2މ5N N"}G8WWPdPBs>] MVSQh褈MPjPAP'} uPWVhpVƿމ }D.@RRj.PGiu \Su u| LQJAPdQQRPpPE PEPh\̾ PpIZËUDPZIt 4$NH}XDPWh%VSEJVJu TRPE PEPh蠆 U}DPE PWh`Uu ]1iu1Bdu1BuD8Djj jPB=|t@dt9t ;| 苅E<>RuBǃt 4I 4CbPlBPlCCRtՋu(fufftCcb # &Z  h}D8 P*> }jj jDP&=f}RjPDP]rtI븍V}jPLQ#rwVVuSE U QjRPh%z 镱 RPE PEPhy ^PPUu P]')}\;~މ;HHDD};{釭EPE PEPhuDž]PPj j9 }jGPSuwE @P8PjSP:t(PE PEPh4muU}5PE PWVw] MVSQh#u铬 މ(PPE hPEPht8} DPb…tRBBB M USQRhWtǫEDPE PEPhh t鐫bu_4Dž@4P}jPDPkkuGMb uFǃB }RPE PWh`Ms 齪R}D8CCP PP|W#b…LC\BC`BCdB Ch9tgA=9)PPrD6PjF61ɉ‰p 0~fDJA9󋅸U8}t>CC5D5Du 9n}jj jTR3C<}jj jDP3C0r}jj jDPu3=wiD}jj jLQG3C, M UVSQRhp E u P]WVShp M}DPE PWhhjpڧ xC`] MhSQhp醧 E hhPEPh0o P.PE PEPho =}D8tbt P23U TRI2 PJ1 C|DDCE}PE PWhnG P]…t^{ClBCpBCtB {Cx ] MhhSQhan ѥ}DPE PEPhh*n隥\VjphtP0d l`jph P0hp uPPjPE PEPjP` t Dž}G8!QQj j0 ËEjPRSF!jjSP葉M}P5E PWVG FMUM SQRhlDž}PPjPE PEPjPp t DžUB8C!QQj j/ MjQRP jjSP衈}5P}E PWVW VuM USQRhkDž,UPPjPE PEPjP耋 t DžMA8 QQj j / ujVRPU jjSP豇}5P}E PWVg fEM USQRhjDž< UPPjPE PEPjP萊 t DžMA8 QQj j. ujVRP!jjSP}5P}E PWVw vEM USQRhiDžL UPPjPE PEPjP蠉 t DžMA8~QQj j)- ujVRP1'jjSPх}5P}E PWV臋 醠EM USQRhhDž\ UPPjPE PEPjP谈 t DžMA8tA8u/u} uPWVh ThğQQj j, }jWRP. E @P(+PjSP蝄U} uPWVSS REM USQRhgDž( uPPjPE PEPjP| t Dž}G8t G8Eu ]8WVSh g錞1tsPPEjPE PEPjW t DžUB8tB8uYM] 1MVSQh,f}E RPEPhYfDžΝPPj j* ujFPS9} W2)PjSP观u ]PVSh4eF/MWWj] 1MVSQjR蚅 t DžuF8PPj j#) }jGPS+u`jjSPρEE RPEPP膇 酜UPE PEPhdDž[u ]WVShd.PE PEPh d  /MWWj] 1MVSQjRV t DžuF8PPj j' }jGPSu`jjSP苀EE RPEPPB AUPE PEPhcDžu ]WVShzcPE PEPh Nc龚 /MWWj] 1MVSQjR t DžuF8PPj j& }jGPSu`jjSPGEE RPEPP UPE PEPh^bDžәu ]WVSh6b香PE PEPh  bz /MWWj] 1MVSQjR΁ t DžuF8PPj jW% }jGPS_u`jjSP~EE RPEPP躃 鹘UPE PEPhaDž鏘u ]WVSh`bPE PEPh `6' /MWWj] 1MVSQjR芀 t DžuF8PPj j$ }jGPSu`jjSP|EE RPEPPv uUPE PEPh_DžKu ]WVSh_PE PEPh _2 MWWj] 1MVSQjRF t Dž5 }W:td CR"M UESQRP賁 BUPE PEPh^Dž}PE PWh |^uPE PEPhH M^齕9t@Yt=MA8tA8uTu}PE PWh,]DžOUPE PEPh]Dž%}VVjM USQRjP} t DžPPj j6! ËEj@PS>-M qVX PjSPy M UPQRh4\lGPE PEPh\?GESSjU EQRPjP| t DžUB8WWj j MjqVP$ jjSPxPE PEPh4[c}u} PWVh[Dž9NESSjU EQRPjP{ t DžUB8WWj j MjqVPjjSPwPE PEPh4Z]}u} PWVhZDž3VEVVjM USQRjPz t DžUB8tB8u/MPE PEPh,+Z雑PPj j uj~WP} GPPjSPtv@PE PEPh4Y}}PE PWhtYDžuM U^SQRhIY鹐PE PEPhx Y鍐^FUVVjM USQRjPx t DžMA8PPj jj uj~WPruwjjSPuPE PEPh4EX鵏E}PE PWhXDž鋏NEU QRPhW^PE PEPhx W2f IESSjU EQRPjPw t DžUB8WWj j MjqVPuwjjSPsPE PEPh4VZ}u} PWVhVDž0uEU NQRPhVPE PEPhx dVԍotrESSjU EQRPjP,v t Dž5 MQ:tK CRA}u} PWVhUDž9u ]WVSh {UUPE PEPhH LU鼌v t$ t AuRRjPE PEPjPu t Dž}G8Ejj jXSU 2\ xQMZËAPD$uË~5xWVhS Dž9 3@~ۋM UVQRh |T$sv] MVSQhSF C tރ~ F uӡ 4WP48 |QW}ZËGPHD$<ËGP|P}PE PWh RR}PPPF P* QRhh^h h^h hPjWV |/E h PEPhiRDžE h PEPhi#RDž阉 } uPEPWVhQ DžePPEjPE PEPjPq t DžUB81QQjP ƅRPVjD^~8 }]h^G} PWShP Q^ SR SPV9E PR@PE PEPh PV_V]u WVSQq 魆uPE PEPPq錆EE RPEPPlqkFPE PEPhN> 4R48|uEU NQRPhYNɅPE PEPhx -N靅UBPE PEPhMmMAPE PEPhM=u}FPE PWhhM u ]WWhhhVSh cM ӄ މ}D8t P } DP P =D=D{u] M6VSQh}LMVVhhUM SQRh8 BL 鲃 Sr:AAA B B} uPWVh K7UBPE PEPhKu} PWVh kKۂMDPE PEPhh4K餂uFPE PEPhKt} uPWVh JHFPE PEPhJ} uPWVh JFPE PEPhRJ} uPWVh &J閁FPE PEPhIi} uPWVh I=UWVSD DžuDžhDžV IRPhPI  ADžVH <0)=1pF1DB u1ۊtot&\#€  Шa X1pDB F1DB uCƒ?%u8{t}<#t)< t%< F€#%t t uPPP)Ѝ{@PWPEPh G C@~‰1nu1Bou1BDž1ۀ8t C8u싅]t4uPWVh0GtS t:yt)t  DžQ ZP }PPPWv ‰ P& XP e[^_]ÊN €\ Шu~#tyrntxuSF9s FP/3lPPEPh\EFDžQ)F@RPV)׃ =EhRPh"E    tFtjU]WVShDQ DžP}XPMVPSQg FP1|Fl F00 w< vDžݍ&'UWVS$EEjjUEEtuЋ]쉘EutE t&u~  UB M싑t 9Du~NpFMy @t ,uFt F Ex,JExMϋqHH9t^Sj]KQV R EÅ;E N Qo^ M1ҋxtx ‰x69u]{wlt xt"tTuFdtJt u6E P?U WPhiBuu}tEM싑||9Mt9MAFu싆U싂Pjhh讧]u u1Fdu ЋUBd8EҋxduMApǁ%ǁ=6= }WW]f{yu~w!tt L Exd2UztBwu_ t4M Q=] RPh/@uFu?uu~dW0G,9BW,uPPj/VÅPPjVCCEPPSuVoCƅ@E9EtMË@Q%@@9 P??.EÍx\0t&EpXu9X\tuF@t BBu쉊ǂPǂP t~umUBVjXSH,Q@Å;Eru ~,WAx1҉^,tx ‹E쉓xxaS E{uVjjK Q`@ƅ;E. { WUs x1҅tx ‰x뛋E싘CHd8RRPhdz=E@EuF [V PNp< %FQ:RPhh=EE Rp:] VPhC0@6C0E@9EuEe[^_]Ít&UWVS1 tn1Qt&FtVtLX PG[S$u S=C0G@C0F,t VD9re[^_]ÍvUWVSƋ9t;F ƒރ FUFx$ V ] E XZPFEFQuPhh^S2  F4PF$WPFxlt HhtRPlRxhWh,h^S1(h h@3]thh h@jNQ4FPluxhtyFt udže[^_]h h@j떃 R@Phh^S0 뀍t&'UWVS Ƌ9t%u9|He[^_]ËNAlu yhm x$ 9}Ӌ)߉F ƒAFAqt!8& ]VE XZPFEFQuPh&h^S/ F4NPWylt QhtPAlPAhPhh^S~/h h@1~h h@jW2 FtYuc0x$ 9})É؋,É,0d VЃN R@Phh^S. Vv'UWVSËHu H@S E XZPECQCuPhh^V4. C4PWCxlt HhtRPlR@hPhh^V-h h@/h h@jCP#1C xluphtTCt&ue[^_]à R@Phh^Vc- 8&륍t&UWVSËHu߉H@SE XZPECQCuPhh^V, C4PWCxlt HhtRPlRxhWhh^V,h h@.h h@jsV/ Ctue[^_]à R@Phh^V+, PvUWVS|}ȴt|^@DtBF$u V6F0F0PPjW,' ȴde[^_]ËSB u 0,EBta$ ȉA h@@EPQW;ES8 EȴD1v tPEPQh C@UM EUE;EFE8EOEZE_ǁ X-HaBproxBy-SeB rverB-StaBte: CEEREt )эQRDPEPsZYEC4PS)PC$PЋH|щTPSэD1PTPPCQhLEUPM0C@Mt\ Ex$ 9}@9|<)ʍ}RPhhEMPU‰UUM B EDEU Ƃ  BƂ  BUƂ ȴde1[^_]è@FCLECPECTECXEfffEPEjPWbu rtswt j%dCt $ tUB4$ t )Ѕ$LJEe[^_]ËE$ H4t)ЅGS Gx F LJPjjjƃtl94ȴL$D E… Шu"AUfTAQ B@Q ;A D$V EH4$ )…uUɉB4$ u;H  LJV:H1~f QWHȉ)΍6P$]P$ M}fEƴ fEm]mƋE)ƃ $ WsEX4W@tJ x$  9!⿉WWBqt=lWt:G@@t1 tn uuЋH9|~ LJVn9H1 QW~Hȉ)΍6P$]XP$ M(*BmE9WUBq)ًET}U WЃU$ J4k)…_EɉH4$ u;t&;H E5$ H4)|WuuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jhjjV @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPV9E#EȴT L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV5 WMSPQV9tJu-G QW RPh]PjSV1@srj t&GLE؋GPE܋GTEGXEPG\PEPV48EE[}}8PPGPht&A jhj jV VȴDF;' ~' ȴML`DDD \DDPPjV(' $ uEH4G$ uڅtʅt )؅~ڋMQ4G PW SPh,/Ӆv)ЅjuUB4у G|@PSjjVd jOlEMJQRGPhtZv'UWVSEtEEEEXdtCvuEEuЋ}D j$7tEEXdEU‰E Ctt$ 2DB @B DF @F$EF0FDF8sHF<^@=$ t S;E S‹EЃ}~4tF t;~y V#uMEFuMEEe1[^_]Í& Sw=~'Et S];E} SLEE@EDU@ RVSEQh1e[^_]ÿ UWVSQ]CE9r`s,C@tI x$ 9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjh' %Ð&UMQPQQA ǂt)H4BJ' P JP ]ÉBBJ' P JP ]ÍvU1҉WVSu} F4tV@хt_tUFtOCRE”EAUU䋀9tl%tUى1t2YQK$K$V BV Xu ؍e[^_]à VЃCE렋EU@9B놉'UWVS uFVEZ9~ }7PPEPVt$XC$u S C0@C09~ |ɍe[^_]ÐUSR' ] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 RQ~JUWVS}]EW(VjPjCDP @tC$ C$e[^_]QWVSDRGC$ C$e[^_]UWVS\EȴTX 9$ 9,JhDžPQSEPt@ ) 2 J AJ ) F$FF(0F5) ) F Ffh# t$  B @B  A C C$C0CDC8RhhRP|9 4lShjQI@ jhjjR @uG@bV^r@BX5$ $ IFCX5$ $ Xe1[^_]PPj:W,' `A룃 RM RM QM& QMK0tp$ P JP tt$ p N8p I CBC ) P JP \P菥e1[^_]à h&t붃 h&bà hPl hD鍴&'U1WVS\M 5p A1DF u1MtM1DF A15pA1DF uGLƒ%붐LG~u+$18u`]0$ubU:EUǀ|B4@<QQPRre[^_]AS@`18uE8EǀUB4ǂǂ|@<QQPROE8E8Ejj jR茥UjEj jPqUEjj jPVUEEǀ|@48@<8VVPR>jj jPUUWVS ]u |tt e1[^_]ËS0PBzXPj WtPPWSt7ueuau]V8 $ t)ʅ~J t |u= @PPh"C0@LPǃ|1F4e[^_]Ðt&C48@8ѐFS0ǃ|fǃ@ t&C0p4߉p4ǃ|1e[^_]UWVS EU@@B0EUZ0J4$E9MAHJEH4EX0CL83E uE1EEpt6CL8v̀C4%1ƉptEC4u'CuCC,C4u u CL8ЉU% = (%`=@%` = `@E1ЩptECL8EUJ4vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@%` = `@1ptEUZ0CL8E9EQP U%%B8B ) jj@h>]) QQSh4<;&UWVSE]E} S詙PSE_؃XPMQt+W‰WUB UEE ue[^_]e[^_]ÍUWVS }U] uWMQCЃXPRgt(SF SEuE }e[^_]e[^_]Í'U1ɉWVS }]u 9s;:te[^_]Í&PEWPEP腚1Ʌu׍S9s'1C@-tvB9s1@-u9rG})9~ы])뒍vU1ɉVS1E] 9s t 1@9r[^]Åt\t""t%,t@"u@˹@1@뾍t&UWVS M}UAtjEU9fY%q 489C9s 1@+uMEA)9AVS4U)޸r e[^_]ËщUf1ҊQ%DfAf%EttUMfU %ҍ48u"9s?:E @E U 9s8:u});E ~ M <:t1MU1D|0fDf%Eue1[^_]PQEPW藘uU X9@%@+C91@+ut&'USE]PEPE PPS7ZYPSJ]Ðt&UWVS ËJ,֋}AXA A$AA(PPA,A0AtN(̀E…%u(C$puM ȉC$uU ЉC$e[^_]ÐEtPGP7VQ9뼍t&US]M C44u!C44u @( t&[]Ít&'UWVSSSUE1ҊA<w.%@@.C~);Eu{9uu ZY[^_]ÃCغ U1҉VSH@pXD9s.<*t(%5pDFu 9s 9/tA9r19tʉ[^]Ít&A9s,1Ft3A9s1Fu+t-t.t9tA<:t1҉[^]À+tȀ-tÀ.u9tA:tF;ur~;}s!1F@+tG;}s 1@+u]uU)ЋS9uPRCPEP轋uҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWRCUM]vE U1DUDUEfDf%Ee[^_]à h<룃 Rg.C'UWVS]u} UCM$3B91@,tЋ^0))؉F4N)ȉF [^_]Ðt&B91@+tꀸ@-Ћ^()B)ػ F,9s|1@+u\)F0낐B91@'uꀸ@-Ћ^ )B)ػ F$9s,1@+ur)F(g@-tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0@-tB9o 딻덐&UWVSE]UM}$4B91@'uꀸ@,u )K0)ȉC4{)C [^_]B91@+tꀸ@-u )s()BC,9ʸ1@+ugu )C0jB91@(uꀸ@-u )s )BC$9ʸs31@+u[u )C(U@-tjB9zu tM t1[^_]øٸҸˀ@-tLB9r붍vK(u ))ȉC,} )C4C0@,tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$,4:&؋M)CXG9sɊ1Ѐ@-(C9r몊1Ѐ@(tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB C9_1Ѐ@,H uC9 ECUX$G)ЃXGG9s WBW9r1Ѐ@,uC9r}_ uC9e uKC9P1Ѐ@-uWMA PQ: %PO)R.  MY$ EXEEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ@, uC9[ =C9B1Ѐ@-OEDX9VUDX G@GDX97UDX G@GDX9r@, C9; C191Ѐ@(tUXU9_G @,V !C 9R; 6C9;1Ѐ@(tUXU9t MjjSq$VQʻ ËEpU)ЋUX_G fzt tM fA fAfAG@ @؋U)ЃXG@WEЍPXW;M EY$jjSPQ!EUGà rG C9,C9y1UWVS u}UE UV EG])ЃXC=^v^F XQPR迀F@xW~ )$ C $ SUCCECESEE Ue[^_]^V G$)ЃX럍t&'UWVSLE}EE dE1UMUIDM1ɋ]9EUM@0EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿d?C9]s]]UZt@MEȋUM\XDN9r&Ẻ ޿h?C9]s捶UEЋMU\XDT9r Eȉ޿s?JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjShx?!U1D\fDf%ƅuMYU俇?r}&U܋U܅M܋QB9uEypу9u΋U]K4fǃ@fǃx$ 1|$ C@1@DA< PPQSwe[^_]ËEEt&ME VY tSQh ~]EǃXEZUPB0xLW;MA0@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8$ t)Ѕ~ e1[^_]áx$ )Ћ |$ MbLJE))ʋM>ʉtWWjS\ZYPFLPCF4F8dhC$puPC$R C$e1[^_]ÍvUWVSL}GW< DBUԋU 1ۋB]ċ,E؉MEPPwVjh?0]܃ }M؋ERjh?P{] uE[]9GE01ЈU@,uqv ҉URѤlM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ@,tMԋ]M9sNwEƉu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjh?Q*x>E0'PEjhq@PwuUωPEj h?Pwtˍ&PEj h?PwًUQjh?Rw3듋u)MSjh?QdwxUB<"<, Ш^Ev'UVS]u fft>fHtUǃtPPjSZYPFPPC$ptu C$%e[^]ÀPC$ٍvPCdPVS辶xe[^]UWVSEEM EP$ыUf@%ETTXUM EMPfDf%E܅<] f%41GD0EEUjh`' j SBP> u?MAw4$4M]ECTXtUM܋EM%1e[^_]Ë]C9CuыEًP I0S[4AC AM|A BtBǁd6EEUB[]EK ujjVS] S3M] MMQ0‰Q0IfWf% ЉfEfH Eh`' @ PSh M $h VSQŬUƒ fUUz0ljz0]Kƒ ШUWVS ]}u_O1tLs$E EX EƋK8ΊEUjh`' j RGP; tUEe[^_]Ít&Gw$4UB9BuҋMW Y4QI0C AAM|A Bt ǁdE뉋MATXҋUBيEh`' G PEPh }M $h VWQS0{$ƒ S0U DXMSjjPE QXjPCP'ƃS f‹% ЉOƒ Шu 1it&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWx|uPE SPW&UWVS EUu EB@@t_J,r)  "Z CZ EɉH,UBRLPVQoMAQ,L) pz Gz UBRLPVSJoMAL^_SAPP襌ơ) P JP E1ɋ$ xzNG@uF @F ^tZ_dtSQQVRPku4CG@UB%U$? ue[^_]Ðw) z O z | h=[ h=jEHQe[^_]à h=0 h=jUJӃ RM$?Cu" UMA$A$9 ܸ Rg'UWVS uE EE^E싻Dtnƒ%uSPEPj;EP$kt:HL‰E]E؃)9PEYPWS8nte[^_]ËE\] e[^_] UWVSlEEUM EX$f@%TLXMȋMQfBf%Eątcuċ}ȉ}ЍUf%E1BŨjh@RDWEu(uu}ċVfDf%Eąue[^_]ËUЋMEEEEE9p}؋}EG}9Es&};€, Шu1DC uύt&U9U]sA<=t;=p,€; Ш>1DG /C;]s =u;]KủM9MM9s:C<;t3<,t/ p%}DA WuUẺU9s <;t<,u׋U:$TMAXu}M)ϋ\}9|l9u׉u^) } B @B EɉmUB`;E}NjuPWVQ2jM8u؋Mv)ȉu;  E@EԋE܅t[ }܋u EjjPWV蜣MU‰MMŰUq0}ljq0uf}ȋvEE u}DtًU)ыu9ɉt&}Ẻ}9E܅tAEԅ ] }̋ujjWVSUfEȋU؃ EȋB0؉B0MĉMủ]9~99u׉}UEdE}B tMM9su>~t F}u9rE9EUt|U)‰U EEtfMQtA ;Eu9u׉uԋ}GE@@UB%y}$? EEu}x $?@EuH9u%E܅8,u}؉u܉}t&PPEPEP) MȋUЋE jjQRPAu}ËNufWf% Љ}EfO f EuM @jjPVQU‹}̉UUNjuȋJ0}̋}J0MfƋEԋI@ uEEEԉMG hT= R ]Mu$?Ft1 UMuy$y$|_t& ͍UWVSEEM UZhf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSLEEU EщEphUu}苆f@%TLXWMfBf%Etjt&EŰUԋM̉Uf%41AD0Ej h@VR…u=}MuWufDf%EuuF,<e[^_]Ít&E}@EuDMʉU9sUӊ<;u<=t<;t C9s<=u9Z;;QKM9CMs<1SЋ pDA u(&;t}G}9us}1DA tߋUBXM英u܋M)΋\u9|w9u׉ui) uȋ B @B Eʅɉ}G`;E}PV}WR_U苂0MIM؋Mu); uD*ًU)ыu9ɉEH,)  B @B UɉJ,BWLV]SQ_MAQ,LMAXRRPFPPO|Å}1ҋ $ Gt ‹C S@C e[^_]Ë9u׉EMt uFu}G$E@ jjEPEP}WԗUű}ЉËJfVf % ЉfEufH HtـuԉHto) 2B @B )  z Gz }GRLPG,PQ^]GL P\ )  x B @B Nt~MRWWNQ\F XZVuFPPz )  B HB i R|& ht=裙 ht=jEHQMUBuTe[^_]BMA#A B @PBPEPEPEPÕ}ԋuNjU}ԋ}fMwtƋwt@ ~ s Rv Rt h=識 h=j}GPWV R9J ht=r ht=jE@à hT=SML R& J QBPEPEPEP賔ủË}fE؉EԋGt؉GtvUWVSM }]Q0BPf@ %PBLf@ %PEPAVQh @h A\]Ɖ)) 9~@RP WPƃƆ  FuE Ee[^_]!W'UWVS,EU}@0R4EUMA4A_\A]9A$sGVPSQ@S]ЋN]Ћs@x!E UHQSRP@x$P M]ЋA4A4ȋs XCE߉PPs,VS(ЃXP===MiEH$pH$2MQAZ@ ة!A$_GhM1fCETfCf%LXME܅E܍]ԋ]Uf%؉E1BMj h$@QDSE觾t?UR$ŨPjh@SBYE̋]E̋ẺC$U܋_UfDf%E܅]1ۅ~9t&~)PGPEPEPxAC9ˋMA9ƋrRPEPEPXUt,0<@M]A4@@LJ]VVjSZYPExPW~UR$Upu MPỦQ$Euű]űẺC$e1[^_]=,q=-?]UB@J06 EjjPS]SOtU]‰OtUOfS]f % ЉfO Ef Ejh@PS]S蝏UԋM fWtM‹MWtI$M=UtDH\`d]SuDuXu BzPBt ]t"C$u[Ct?88][$]̃uVEP@Z@ ة!t>~6EЃx$Z@ M|_0IẼE̋EỦP$dGfxt WtMЋ]f@ f@f@UA K,‹C$)ЍPC)9r*C,EЋULJB4B4])s0։s0PPEPEPEP]SBtDH\`Q/@tQPh=臐UX/@tMRAVh=jP ]PPEPSBu(>PQh:@h TUÃB ES_h SPEP輸 ^MA@t ~tG\UЋEZ ؃XEƋJ VuPVhT@_O1]fATfAfӉ]Á0fM%U4VQRh[@O1DD0EfDfÁ뱋E@4AP]ЋGxPGPEs XP1aUMЋY@x#] CPQRSCx$PU M@]U@t,0M]AC4LJ<@PPjQ蟺^_PsPVcxE@$Epu @UẺB$E]̋M]̋]̉Y$sUЋJ@x&M uAPRVQAx$P/] U@M@]t,0UMBA4LJ<@QQjR踹_]ZPsPVywE@$Ep0 EЋ@@x$U BPEPEPRBx$Pq M]U@@t,0M]AC4LJ<@VVjQ_ZPsPVvE@$EpfPU EЋX@x!U uJQPVRBx$P M@]t,0UMBA4LJ<@QQjRJ_ZP]UЋJ@x&M APERPQAx$P] UM@AB4<@Y$]pu ]̉Y$EDE E̋EỦP$+My,RP h'PbO ωEjhb@S]PS胳 %cMA(^y]Ux$ )ȋ |$ )Mb)ʍڋUщRAJ@!ȩt"]PjCL@ PCP@ PEPUOt ǂR]ǃǃ]33 Gjhy@PEPEPB ][$]'UWVSM EU`AU9A$sESPRQ@}UEP@x!U u zWPVRB|Px M ȋY4A8Y4]S ЋS$XC芵`EXlM]K4]IE`X\{8s8] t&u:?9 `MjPQSWK uЅ%tƋ}`|$ x$ džQQjWN_ZPE pLVr}w$pu Pw$u Ep$1e[^_]Ë}G$G$Mq$urY;]tj@;v x$ 96rFr;vEp$p$` MYQCJ ȩ! `1u {$[fCDžlTfCf%tXtpphthf%<1Bj h$@WSD8t*t6Mq$Pjh@SINEp$`plYfDf%pM]1~9`^t&EGP\PE SP蓭U9ՋMdt`u^@@9B}uD9/ `jPEPEPCP#‹C xuŅ1҈…tEE C=-=// 5|VF|GG=^ uQPRVG{ rWK =ZEPQCPRFCwƉwUK G W`u W|$ C]x$ PPWFLP}w$*EËxHH9uuD?9| `jPEPEPGP‹G xuŅ1҈…t_ UZ@;v x$ 9zGz;vEP0p4F BBU|B ࿉Ct @Ct Mǁd]s$s$Ex,eU@z;v x$ 90rFr;vUыr4R0F BB|A ࿉Gt @Gt udžd}w$w$;]guj@;v x$ 9lJAJ;vUB$B$sP}_6CP9F `}jPWSNQ2‹F xuM1ҋY륋EX}RPE PWZ}t E@@x$U BPEPE PRB|P `] uAǁC4WWjV֬ZYP{LW:kuFdhr}w$UZ\ tjjVS] Sc|`th‹K0tK0[lfWf % ЉffN USSQRcu F4 jh@WS] S{`h}tV0ƒ fV0w$tju PAGEP$P$C t E@$DuDu}WXt`uVCr t}ffQf  C B}w$uEGW@z !t0Ex4UE Z J0Ȁx_0]s$u} 7U B(^z]2]`x$ |$ S0BXJ(B B$B B,B0Bt} U $ G4G4B1ҋ|t ‹M ҉Q8u$ e] C8^$;, } 7EUxJ(QR,Rj?Pp=uM FQ<  )r}4uE O ȋW0Ѐx_1M 9, ] 3{ xPf>xEG SeDt-CoDokiefD : GUGVK QS$RP>C wUGf OUO`0d`p@H΋PD֋d)Ct19}d<?@9|OS=Z"CMRPQ>COOGUЋdQVRP=GGU|/C=Y /G@GM 1S]E K QS ЃXPEPu^}PPE PWMQY}f,$x WcWtM,!;]Kt,!;u$,PS Ph Ë`Sh P`PE Pz IU`Mx$ ǂ|$ SSjQZ] YPCLPMRUPB,PE z(XPkMYC t!; tM!;z}ǬPVPh t;X1ZGP1GP1GP1P h@P =Ƌ`Vh P`PE P. Y]S[C8/t*]uE }UN ȋ_ pXSVRh@E1fCTfCf։ǁ`Qf%0ESVPh@~`V1DtfDfǁu^U;J,r(E hpX9M߉]pA$p A$9l `jPEPSVH ~u %6&)  Z CZ `ɉPu^ ~}E W VSXPQ;9`M QS E ЋuXC~,ËF Å) } j hSSWr} wƍDwjjPE _XSjPW覰Å`; YG f% ЉG U 2G@xM APWRQA|P }u ]GF4dhw$p Džd@uC`P}N4QSW E ЃXPEyE 0ϋr)ljH#BBEuj.VPj 7}WWPËQh  7 Vh@P8Ë`$h P`PE Pܜ eMQYSVQ%(M $ Q8t )Å  UB@x!M APE RPQA|P4 `}ǃPPjW[^u PNLQe^U}BF4dhr$pu r$Mq$pU 2 M jh@SSQWoVƒ VUBRSPYuF@x!} GPE VPWG|P3 `]ǀVVjSZU YPBLPd]uM] FC4dhv$p$WS Q]YrT)ƉHBB] @҉37u1ɋ$ Ft u} O8 ϋr)ljHBBQ hT=$q Rt EEP`PWjh@1] } t4MYlϋr)ljHBBrMERj h@P4EX `E}uWS@EPEjh?舚E tg}~aMERjh?P64uDU B42B4-UZTB&M 1 r MEWSAPjh@E uUM]UB19ڋ,|9s EU19|9M Y41Y4PE}PEPEPbe]M}O8_#FF 1ɋ$ tt)NGGWWиSrvUPPUB(:u# u%tt/PPjB P4' ËBBPPjJ Q0' BBPPjB P4' ƍUWVS u^,> FF ȴDC,ډ\K,ST % = 0%=8C tUC,u{Tt%"=F(Pt+F@u%P =$ Et UUP)^K$u S]S0S0e[^_]Í&CTtPPjF P0' FFCuC1ɋ$ tt K #aC1$ tt lj{> Vx2FF F ȴ DF ȴd~ W8' ^^C0u{,u [T>UPP t$ A @A t.B @B$B0BDB8tF$ B@tHB4B<tJ t;By R[@1à Qf뱉UWVS =tt 1ҍe[^_]Pjjh@]) t)  ) Et=L_d;E~Et P9}Ƌu⋿uË}GS}jMFQh@Ƿ) >RjVh@覷 ) @ hPjjh@&UWVStE#$ UuDtfEPuEPuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]á@t:tt2CuAPPhAh  Ph jCS PSUSRu$ PE4$ U_UE PEP%Ív'US] t) P JP Kt ) H IH ) P JP []ÍvUSPtv PPQ0uC t SV9tlC$t- CP8SDH tt$ X KX I ]눐UWVSEUBhJdZ|@E ǁ uE9]}`UU1Ett A#;EtK uEU䋏)ى<@E9}UBd뮋E[^_]Ít&t01҉ƅ;E Шtϋ u낉낍&UPd@l@h@x@tǀtDBt2 u.t*t.Alu Au@AlAxu]ËAh@AhAtt&U‹Hht@tB|]ÍtǂB|]ÐBxB|Bl] UVS]Ss;StMu3uSS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉCS빉UWVS}GdLJLJ  LJEÐu]䉷EEt11ҋCCtnEȉEuЋE9E}EuSSjMQLJF}e[^_]e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwlNGxwl9tBtt ut቗l kuffSSe[^_]Ë;䍇GGtGhHGh P>ǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPSe[^_])QQPW辳jUWVS u^ddždž dž dž$&CCu߉(FtFx^ddždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPW-t&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFxFl@FFluP؅tt>9ut6.&;aiFtFh@FhO(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AtAx;B= P趭 UZ(B$؋Z )1dELGGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P蘬 V聬E싗Y[X)ЉVS迭vUVSuue[^]Í& SXZV )1SPGe[^]Í'UVS]SKs9tKu4t uu=fSSe[^] uu;u܃tBVx)‹FlHVxFl9u8tBtt utቖVt)‹FhHVtFh PǃL'UVS]CKs9~uCe[^]è ut胻t vtZFxЉFxFl@FFluT؅ttB9ut:2;v~FtЉFtFh@FhS )1PPPQGCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xxωxxS )1QQURPESCCe[^_]Ë9]e[^_]a]e[^_]aE)ptΉptY Psv'UVSu^ddždž  dž0dždždž$&CCu߉A^ddždždždžt\CtG uCt?tHS )1PPPPOue[^]Í붍&U1WVSEUu R|PEPj?VÃ1MC؉])u)ƋEu(E3vWuVj&SÅCM؋U)ȉ])‹EU9EU<=uM9$މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1q|e[^_]Íe1[^_]Q_ v'UWVSLEEp0@ẺUЋ(@|M1ɅHSCz< tz>FU1ɃX)UEM EEPEЃPCPjh?d]܃ }M؋ERjh?PbF(EX;EEPX1Ѐ@,ua Sl'tllPЃ vPɋE]CE]E ЉEF(X;E+M1Ѐ@,t1Ѐ@,tU1B@,u 1ɍe[^_]ËMMMMċF);EsEċ],}PEPj&W ÅtCu؋M)])MċE9EvUMȀ< =uE9$uMȋE)ȍ HEčZt9B01҈€@(t`UCЋUЋU)MĉEt<&űM̋E1q| Q>XEM1ɀ@+ut&UWVS,1]sEԋV|<E1tL EEPPEԋPREP8P[bE܃ tEu 1e[^_]ÉËME@u=AЉ)Ku1v|e[^_]VEYhLE"U̅tЉ)IKt<.uڋE̅uEv'UWVS<E@$Ut SSjP^MYCp%EǀC UtM1A$A$}t_UM9*UMBQ4ut3At-EX,t PbU9B$s MQe[^_]ËK||=Uǂ7=Q=KS 2$=Nw=uǃ MQ^WMyE1W|Uǂx;G|| LJ1EEڋC4F,j;u{u]9_|%!9uË]t MEU>‹E;@dhEǀMfff EǀSSQR2\=LE EE=0t)9~%!?EЋUЋU)ЉENfG/űE@EԋE94fuS|Ƭ1tSEǀe11~#v1Ѓ9v1s|ыMbEKhEɋt@uƅC,tAK4t)F @u@1ҩt t@u‰뻃 S9C s96]빋MMKhuSlEEEF$u F(F$F بt@utEF 9w:ЅtuDžuwEiFVFF(EVF$F 말t&Ft&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC PӛF @F G,t)G4tE}艇 W!9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EMMUMPEU WPJQMEHxU1W|tWXx;G|| LJ1EE*;uuȉ]9_|%!9ڋC4F,tà V9F$s밉؅ExE1񋃐UpLSlA@SYW Rj&P EPUSXK| V9F$|]ȅt M̉EW9C r䋞48FDH\t&UWVSLE@$u PpUB0XPPjjjƃC %94\ PhjV\@ jhjjV @}WB0B@EC%EE==E EC\E؋C`E܋CdEChEEĉEEEċ=ȴL8$\8 … ШuAQ Bf\A@Q ;AAU]ȅD:$LMIMȋMA E1Ut,QfDQ%EB;AEHA EUMD: T9 D9$ffEڋEPEPEPVwBEPj]èSV@} ȴG0@PD D ȴO4LqO0D yDL \DF;' ~' WWjV(' EUH0AP=Z$@Z$P$BP$;P(X}W QЃO0WMQAZ@!ةPPVA0@L@ P}WB%11==9vWPSV@Åm V!KRSS}GQhiXUD8jj jPUjj jDPU0E: 1lu1Beu1Bnu1Bt BaUD8(jj jPoUjj jtVQU@4g1Cr1Ci1CB UB8U Bp% Bp$RXE@PU $E@PU (UB8B UB 8+U,ǂ,0$B.sPPj)VÅ9 ШU Bp8% BpWU)<ZYPVUǂ@8UB8)BEǀ@Eǀ,EDPhDEPE PkE|WhD܃ PwU,EShEQhDEPhxEPhEPhFPh\FUWVS }u]G Vt@t(tPPF PPatuԍe1[^_]ÉtChu te[^_]ËCl썶UWVS u}]F Gt@t(tPPG PPtuԍe1[^_]ÉtSdt Buue[^_]ÍB,tJ8dd1gu1Biu1Bdu 1Bt&dddp LQ@$pd:tjd1uu1Biu1Bdu1B jj jpDPvp d:uv hd# 4@4e1[^_]&jj jp@P…)4=)У4뎍vjj jpDPjjjp|W(p tV@PtjPpAPu\tto0VhHUREP$e[^_]QhHRh,I؋pLQhtIVhIPhI볋p\Sh^d?SShuREOQhgh^P> PPh?uRd?uRGPEhgh^P_h?]P]OQMhhh^Qh@hh^SXZSE P!1҅#tfdžfdžPWSV1MPhGh^QQ[E_PM Q1҅e[^_]áTTXRRd?hh?uRMGPhih^QM %KMPh Hh^Q~Phh Q <Et&UWVSEu} E $mPPEPGPP fdžfdž x$ $ )ѨPXuPTPP̴дSRP$ P0P,P4P<81PS<QRf1󸉈QR1ųU RE.4RRUP(Phih^RAXEPW1҅tfdžfdždžfdžt5)v{ t uAfdžÉufdž%e[^_]Ðt&PjSVu1܋넍vKUPPh^RY[]SW1҅y%눍&USP]|t]PjE PS}tǃ|]Í&UWVS\E }(z|t e[^_]Ðt&uEE t&E fLJLJ|e[^_]ÍE;Ut BUPB4PC0@PC0Phjh^VS0J ZPhHh^VS0J8PhHh^VS4JPB4PC4@PC4Phjh^V{S4J uPhHh^VTS4J81PhHh^V0SLPKDQSHRC8Ph'Hh^VPC|PPCpPhAHh^VSJ4 DPh[Hh^VCP$Phh^VY^uVU RÉ) TC PShcHh^V3C f@% 7PCH8Qjx$ )PZYPC@0P|Phkh^VS0JQhB$ )P S0v@DPhpHh^V|t&PPhB4 $ )PxPh$ )R] Kt&Ph$ )R= t&QQhB8$ )PQQhB$ )PkQhB$ )P S4QQhB8$ )PQQhB$ )PEj4PPj螲ff~HtRUCPCPQRhHh^V E fLJE LJ|hEj4PPj ffbPPVU BPPo‹) EfLJC US Sf9A}&UWVSU (]|te[^_]Í}EhE <U|tt2}x9lttG9luoEUt;ASh8kh^h]QXZhSE Pu UEǀǀCvTUǂ} Eǀ|e[^_]Íx$t]뺋}t;pt&hUYPxlpl^{ 9t+RVhHh^hPt ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡpDP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM Q}xމt;XN\L\El9Zh\hhSZXËDxsh^XDȋhr^ZDret]ߋ4nPPWE @PP2 tǃǃǃ}E|VVP|PLtY[JMb)RUREPEPElPE@PEPhkh^hPt0fz]j.St$Pj ګMt G PwVGt|RHtRtBtlRHtRtIQS]lRPhkh^hP@PPhWu VB]ǃtGfh G@GpÉxHut G PGPGt|RHtRtBlWBVJQSMlRPhHlЍ] j.SPj]M%fǁǁ|Uh`谯ÐUWVS<1] utKt:EEEEtUfBfEڐt& jhjjV萧 t5EQjPV|x 1҅ttR1ҍe[^_]ÍERjPVGɃ jhjjV) 2 E܍UȉEfEj EREh ,fEjEVEԦ @t Ej Ph ,jV踦 @H@UBE jhjjV肦 Yt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %PÃ94PhjS@f jhjjS @H jhjjS裥 @F jhjjS{ Fr-P@ PF PSK@WWuPS蘤@F ȴDC;' ~' ȴDDD DtȴDDUE…%u Ee[^_]PEPEPE PcEEEm S訢EEmEE,n놃 W誤@$WjjS @EELnE jhjjS @p jhjjSʣ @REElnE=& jhj jS萣 EHmEEE_mEMErmM&UWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]ÉAǁǁ@] UMyt]ÉAǁ@ǁ@] UWVS } u FPXW8 $ t )ʅE‹X\t&uMVB\9tGCt: EPjVRCPeD ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF4@@G4@@FdhF$pt@u F$1e[^_]Ë_8ۉuF@Xt$ tG81рPF$븸G8t&UWVSEEX;mlm%ME9MUZE8t#mE8E1ۋP %itֿ8PQE0PEP@Å9@tPPPhSCEtH m@pumRQhnEP}WE VVjjqMUP XQ`PA`ʃ\Ee[^_]ÐE9E*MEP:tESjPREt QU RPMAPPhnEPEPDE ;M%u#e[^_]1Bfp1BfUPhm})ω}uVEP뵍t QhURPMyW1VhTEPEP葟e[^_]ËMYXuUEBX1t QU RPMAPPho뙡t SOZUYWPM1VhDo]SMQt QU RPM9WqVhlo븋M VUZSMQPBPPho냃 SUShooU WM^Y SURPAPAPPhpEPEP8 SE8WhoM W6U[^J QMRPh@p&UE Ut@0u1]Ë@B |]Ðt&UWVSE tx0u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9EE~x11ҊCS1҉E1CS}B=G_(؋O )ȃX9}9|EU@ |o]C X~1CE Uh0$@$$訡$\4ÐUVSu] 9t"u'tC @C Cu/e[^]ÉBJ IJ udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@HS4FUF0@Tr^4CTPN0tp$ H IH tp$ P JP N,t) x Ox ]tEHtU싂H IH Exx5Ex4tGU싚t C tCP JP utU싂X K8X Et) H IH Ut) P JP Et) x Ox V~9׋u<ًBABR) tA BQ J9׋uŋF]BF ) 0p Nۉp t Uz e[^_]ËU싚t C tCP JP uU싂H I8H {࿉F$FK$S4I҉K$C,t S9C$ P$ P^4 P} P~CFSSjV`@ p$ Q<EZP<X) P}<X) Pq<X= ) Wd<U^ST<UEe[^_]9<'U ) ) ) ) jhhU: ) %ÐUVSuF0tTPH@D+ t,FVlp9t lpuqF4tfPH@D+ t>FVtx9t txttx[^]lp끍&'UWVS ] uC,K(C@A  up t^x$ )Ћ |$ MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK Q}S01uC4CC01^'UWVS u} t F$@F HF uQFDHG_0uG0$ Ge1[^_]ÅFt48듃࿉F$C$HC$F HF pO0 t$(F48tS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@&F%S4ut0Ct*C,t S9C$s PF$F$vG0_4C C,t S萵9C$ Q起GNUWVS } uG,_(EF@unC(^{]Ft \ tZFV@r!tEQjW RUBL@ PyY*C4C(XC4{Wv,dž$ E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$x$ )Ћ |$ Mb<))ʍe[^_]Ðt&C,@u kU CSS$SC0 C0 3] ue[^_]Cjx$ )Ћ |$ MbC<))ʍF48 SS$SC,{0uC0 B V趡a\x$ L`L]9\A@AP;XXF@CCF$=p{{] ue[^_]LC,@u u F@x$ )ȋ |$  )ѺMbC<)ʍSS$SC0$(S{0C0@{4tX\ x$ L`LM9JAJP;XvXt$(F48tAW4ut0Gt*G,t W蓰9G$s W輲 SS$SC,x$ )Ћ |$ Mb<))ʍbuY)ƉHtHAEALJMM)Ht!BMBLY뺋EBލt&UMQ$u!ApuAdhQ$]ÃtwQ$Q$ރtytt Q$ȁQ$뽍t&'UWVSEp@@0' ^0N4$E FHM m VpecN4 ^0CL8 CP8 ;E uU1UEptACL8v̀C4  %1ljptE X C4u u CL8 uC0t \ jЉU% = H E%=%`=@D %` = `@ SP:u"t%=%VpBwc^pJFpQQPVVpu.tϋ@tF%tPPFpPVfVpt^0E1ЩptECL8CP8E N4t&EY uE1؉EEptAALڃ8v΀y4 R%1ÉptE A4u. u&AL8vA9A,sA, uA0=! u;A0t4\ t+д90~VFz@ E% = %`=@%` = `@SE1ЩptE^0CL8CP8U9Es@ AP8 : F@t F$AP8^0CP8 N4F8FXN4z^0:)C0C,@_WWSVJ^0t ALPPN4A APPPVpB ^pS$$販F<@t,0^0C4,F4@4F$pu@F$ F$t&V$p V$VX^0C4@Ѐ@ CLPP^0 CPPP^0V$0V$`F$pC4N$ N$VyX^0 a YF$@t ࿉F$Z$KZ$QQjVFtAS4ut0Ct*{,t S蜣9C$s Qť^0S VF$ F$nF8Z ^8SVP$VT$蛧^0C41F4@4#F$pu F$ F$ F8PFp$ ^0¯uC $ t )ȅ/uC $ t )ȅuC8 $ t )ȅN4¯uA=$ t )/uA=$ t ) A8=$ )t~p ~8 N4^0CPHFIF$tFJ$ H$ @x$ )Ћ |$ Mb))ʍډVlXt+F$ u%F@tF0PH@D t V VMEx t! Pg%U9u Mq$t4 ȃP7%MKQDMtt$ MP JP H1vt CLPP^0C CPPPmt0V$V$t)QF$F$t4F$@F$t@#0PPSV;F$0ʃ 0GtWWCPf@ %PF0@Lf@ %PFSQhwph }Ph jy~<@PPfF|%PfFD%PFPWhph }Ph jx~tPPfF|%PfFD%PFPPhph ?}Ph j_xvUS E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVSE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$PtE @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP蔔%Ðt&UdEP`d]ÉUEPQP@ ]ÍUWVS u }PPWCPct9ue1[^_]Íe[^_]UWVSj(EPctu=``tSu)E_t:QUsREPCPeu CU<tCu΋?`ue1[^_]Íe[^_]à EPe}r&USRË@tS u CPf Sf]à P҃C Pmf؍t&UWVS ǍX@09uG __uGHIHe[^_]à PfGHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjjeEtU؉PJEAJMA AAAWWj(S)atV@EQQj)PaRRNjE)ǍGPj%eÅPWEPSdE܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjjT]t) EEj Sh ,jPP 1@tЋ]O]81҈ƒUUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVS,E' EE9E =U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Emu=@-  1ۋ=PESPWLY^PES1螞U;u%t1t&|u FU;u%uӍe[^_]ËEH E؃tȴ|t؉ڃ t ȴ| lDZ FST Ju $ E f1)ЅM )CM  SQ&'UVS4uP j5Ot\PPSjOt5PPSj Ot e[^]à PO PN1F8Ѝe[^]Í&US]PNXPNYRNC8]U]ÍU Ĵ |)A Ĵ$ ǀ$ B4B8B,HB$GB(HB EBDBDB DB`EB`EBDB0E]ÐUSQ̀Ãv JۉZ[]É'UMʃɋU B]!Í&'UWVSEE9E5Uu衰U1ۋuǃuɋ9tRp=tɃ̀ÃvIۉ5u]EC]9E`[^_]Ít&'UV5SӋu%@ ؉[^]ÐUWVSSE] ƉEC<1uE ى Z[^_]Ít&'UWVSPE] ƉEC<1t!E't: wUU- P24EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ469sUډ@C9r18}t MQ6F w$x p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$؄~1ۊY!#E9t]υt=p1A1ҊQ 9At1t1p%뎉[^_]ÍvUWVS1]1O~PP$ E PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1p%`FW1C1ҊS ƃ>FC4M!1̓w3$P1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊpL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ pT$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$pS!1C!̓w$p1BR Ѕ~1(jjj1pPÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸DzNju =Dzt3%9uyVPEP, uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$EU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0RTz}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCSDT`MMT~`U(RjjTQtWTVP`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Q` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q>` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPPE`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSPq u @CRQ VD;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM111ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$dE%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEܗMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $TjE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$H@vP@t<)u担87DžRt#H@%u㋅8) PB<v?t { 5B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WHЉƃ؅uDžM ERCP~NF fF(ffVffNfF}ܗtSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VLЋU+M M}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$̏]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB P-C MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh XU ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PHЉEupEEMP EPRQUM$ ABLErLPjURMQEPURCPV u'EMA`Up9RL]Ex`UH EPRQ1C1ҊS à ;AoEUB`Up9&RLM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQD[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE ƏDž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžܗE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPHЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Default settings : maxconn = %d, maxpollevents = %d Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Could not open configuration file %s : %s Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789: 'D S@g{  @U@  splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsindependant-streamsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' Invalid server name: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootdescriptionpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledhealthenabledbind-processevenappsessionrequest-learncaptureretriesblockunlessredirectlocationprefixuse_backend(unknown)force-persistoptionhttplogtcplogclear-cookiecodedrop-querydefault_backendredisprealmhttp-checkmonitorfailbacklogfullconngracedisable-on-404send-stateappend-slashhttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForheaderHELO localhost HTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 EHLOHELOcaphdrrewriteindirectinsertnocachebalanceserversourceusesrccliexpreqreppostonlyscopedomain%s; domain=%senablehide-versionshow-nodeshow-descredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackclientclientipreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionintefacehdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d]: '%s' expects a string argument. parsing [%s:%d]: '%s' requires valid node name - non-empty string with digits(0-9), letters(A-Z, a-z), dot(.), hyphen(-) or underscode(_). parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : Unknown host in '%s' parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : Socket path '%s' too long (max %d) parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : error detected while parsing a 'force-persist' rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable', 'hide-version', 'show-node', 'show-desc'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : '%s' expects 'code', 'prefix', 'location', 'set-cookie', 'clear-cookie', 'drop-query' or 'append-slash' (was '%s'). parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. Maybe you want 'maxconn' instead ? Maybe you want 'fullconn' instead ?parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots nor does not start with a dot. RFC forbids it, this configuration may not work properly. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: '%s %s' invalid node name - should be a stringwith digits(0-9), letters(A-Z, a-z), hyphen(-) or underscode(_). parsing [%s:%d]: out of memory. parsing [%s:%d]: '%s' requires a parameter or 'desc' to be set in the global section. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: '%s' has to be > 0. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'disabled' ,'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d]: line too long, truncating at word %d, position %ld: <%s>. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracking: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracking as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled again; name=%s/%s; node=%s; weight=%d/%d; scur=%d/%d; qcur=%dCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPDOWN %d/%dUP %d/%dNOLB %d/%dNOLBno check; throttle=%d%%HTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)undocumented 'timeout appsession' may not do what you think and will be removed in next versiontimeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. config : 'option httplog' not usable with %s '%s' (needs 'mode http'). Falling back to 'option tcplog'. Proxy %s stopped (FE: %lld conns, BE: %lld conns). %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. "6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket (%s). Aborting. Invalid empty name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket (%s). Aborting. error when trying to preserve previous UNIX socket (%s). Aborting. cannot change UNIX socket ownership (%s). Aborting. socket(): not enough free sockets for UNIX listener (%s). Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener (%s). Aborting. cannot listen to socket for UNIX listener (%s). Aborting. cannot switch final and temporary sockets for UNIX listener (%s). Aborting. cannot bind socket for UNIX listener (%s). Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE`3HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready.  I y  =p:%^^^^^Z`"1#""#"!G"%$,$$,$$O$HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough memory process_cli():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). Not enough Memory process_srv():asession:calloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valshdr_ippathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/srvrepsrvhdrCache-control: privateConnection: close: %d.%d.%d.%dclireqclihdr: %s /Expect100-continueContent-Lengthappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratefe_connbe_connavg_queuelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓no checkMAINTDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,MAINT,emptyOPENFULLSTOP activeY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,

%s text/plaintext/html on unlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max,
%s%s
%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,DOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy%s%s version 1.3.24, released 2010/03/30

HAProxy%s

Statistics Report for pid %d%s%s%s%s

> General process information

QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle
Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s
Backend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%s
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%lld%lld%s

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits: memmax = %s%s; ulimit-n = %d
maxsock = %d; maxconn = %d; maxpipes = %d
current conns = %d; current pipes = %d/%d
Running tasks: %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.24 Release_date: 2010/03/30 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d node: %s description: %s rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: <p7Mpe*3req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endjqoq{qqqqqW>yqW>qqP>qqP>qqqP>qqP>qqP>qqP>qq>rrs>@ro>-r/r?@[\]^_` >z8z2z,z&z zzzzzzyyyxdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error b&b&b&b&b&b&b&b&b&bccccccccccccccccccbcbccccccbccccccccccccccccccccccbccccccccbccbkekeeeeeeeeeeeeee#eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeoeeeeeeAeAeAeeeeoeeeoee*f*f*f*fefefefefefefeflfbfbff*f*f*f*f*f@f@ffffffffffIffffffffffffffffffIfffffffffsfsffff*feeeeffff*fee*fff*feffffffffhhhhhhhhhhh#h#h#h#h#hhhh#h#hhh#h#h#h#hh#h#hhh#h#h#h#hh#h#hhh#h#h#h#hh#h#h#h#h#h#h#h#hgg#h#h#h#hFhFhFhFh#h#hhh#h#hhhdllB{dlssls&mlosdlZp>ppppxp|{{{|}|||}]]ppp]]ppppZpppppppppppppppppppppppppppppppppppp8pppp88pppp8FژژژbgQQژژFژژژژژژژژژژژژژژژژQژژژژژژژژژژژژژژژژژژژژژژژژژژژRژFژژژژژژژژژژژژژژژژژژژژژژژژژژژژ\7ooooooooooooojoooopooooooooooooo\\\ݕ\\\\\\\\\\\\+\\\\\\\\\\\\\\\\\\\\\\\\\\ԕ\\̕\\\\\\\\\\\\\\\\\\\\\\\\\\\\ĕIZȪ4WYߩpff33)VH/1QkQ՞"b߹ڸ'8IYlԼ< !!їʗ}tqng ` ]U L D 90'ږЖȖ !"# u$r o l b%Z&XU I'FC=(2)&* +,  -./ݕЕ0ɕ123456789:~;{<yvspZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;+,(zR| (' (H( pn 9HP[$  h( ` ԏ8o\oo *:JZjzʓړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjz 0'88z~ "(/6=DKRY@)`(@`/)`/))@(@)(ppppunix_streamnlq y` ``456`6P>PeefW>pff0$_>pf g0$h>)g(o>0)g0$s>0)g`%{>0)g%>0)g0&>0)gP(>0)gp(>)g$>`/0h)>)h(@0)i0$>)i$>0)i`%>0)i%>0)i0&>0)iP(>0)ip(>)j(>)l(?`/pm)>0)0j0$>)0j$>0)0j`%>0)0j%>0)0j0&>0)0jP(>0)0jp(>) k(>)`l(?`/m)?0)n0$ ?)n$?0)n`%?0)n%(?0)n0&1?0)nP(:?0)np(6t748 99:p;SA)и(YA)p(cA)@(pA)к(}A)`(A)(A)`(A)(`FF8FZFFFFFFFG GG(m)(0m0, (? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&-ic9-$-c$C\DD$ c$J\cIDK$"c$R\cQDS$"d$p\doDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$ ]DDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$]DDD!D(D7$;d$]DD $d$]dd DD DDDD+D/d@d@d@/$/e$^dd #eDDDDDDD*D1d@d@.e@d@1$19e dE^libtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)Pv690:PsIйOy@;Q@`v 0 -4zѢ;py %\ߏ\s0n(` 8`-J:0Uq@0 pܧl!#O 9G<P=^BVP?^DfD{I@Qq H0v6+display_version+display_build_opts+usage,sig_soft_stop-,sig_pauseT,sig_listen|,sig_dump_state,dump,init/deinitg2run_poll_loop2main4global4progname4pid4relative_pid5trash/5zeroA5oneS5nolingerj5stopping5hostnamev6UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)9%a2base64base64tab8:HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_authBstats_set_uristats_set_realmstats_set_flagZstats_set_nodestats_set_desc"stats_set_refreshdstats_add_auth,stats_add_scope_O3w%ultoa_r%strlcpy2&ulltoh_rz&limit_r&str2sun+'ishexR'invalid_char{'invalid_domainchar'str2sa1)str2sa_range*str2net,url2ipq-str2uic-url2sa.encode_string /str2ui/strl2ui 0strl2uic0strl2ic-1strl2irc1strl2llrc1parse_time_err2my_strndup3itoa_str3hextab$ init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace0 buffer_replace2 buffer_insert_line2 chunk_printfW buffer_dump pool2_buffer-F'Alert'Warning/(qfprintft(get_log_level(get_log_facility )send_logR+tcp_sess_log-log_facilities2-log_levelsT-monthnamev-sess_term_cond-sess_fin_stateQ+$__task_queue@%__task_wakeupz%wake_expired_tasks'process_runnable_tasks)init_task*nb_tasks+run_queue+run_queue_cur(+nb_tasks_cur:+niced_tasksL+pool2_task^+last_timerN_tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnro Z get_pipe kill_pipe put_pipe pool2_pipe8 pipes_liveJ pipes_used\ pipes_freeR ?'$exp_replace%check_replace_string &chain_regex&pmatch-4nO/warnifnotcap0warnif_rule_after_blockZ0warnif_rule_after_reqxxx0warnif_rule_after_reqadd 1warnif_rule_after_redirectb1warnif_rule_after_use_backend1warnif_misplaced_block2warnif_misplaced_reqxxxf2warnif_misplaced_reqadd2cfg_parse_global:init_default_instance:cfg_parse_listendfreadcfgfileicheck_config_validitykcfg_register_keywordslcfg_unregister_keywordsmcfg_maxpconn"mcfg_maxconnnsslv3_client_hello_pkt0Ѣj%$srv_downtime$srv_getinter/;4-process_chke2start_checks($srv_dynamic_maxconn%init_pendconn%pendconn_freeR%pendconn_get_next_sessk&process_srv_queue&pendconn_add'pool2_pendconn0 %6+get_frt_addrO,event_accept\3a(proxy_cap_str(proxy_mode_str,findproxy_mode-findproxy-findserver}.proxy_cfg_ensure_no_http./start_proxies/soft_stopW0pause_proxy0stop_proxy0maintain_proxies$2pause_proxiesW2listen_proxies[3proxym3next_pxid3listenersߏ}8'uxst_add_listener*uxst_event_accept_-unix_sock_parse_request;0uxst_req_analyser_statsc1uxst_process_sessionN8unix_sock_usage_msge8unix_sock_usage\g /init_proto_http/http_header_add_tail0http_header_add_tail2u0http_header_match20find_hdr_value_end+1http_find_header2>2http_find_header3error_message4perform_http_redirect5http_return_srv_error5http_sess_log8capture_headers9http_parse_stsline9http_parse_reqline:http_msg_analyzer=http_capture_bad_messagez=stats_check_uri_auth=?http_process_tarpit?http_process_request_bodyAcheck_response_for_cacheabilityRBproduce_contentBapply_filter_to_req_headersCapply_filter_to_req_lineDapply_filters_to_requestDmanage_client_side_appsessionEget_srv_from_appsessionLFmanage_client_side_cookiesFHapply_filter_to_resp_headers=Iapply_filter_to_sts_line Japply_filters_to_responserJmanage_server_side_cookiesnLdebug_hdrLprocess_responsePhttp_process_requestdpool2_capturedpool2_requridhttp_is_ctlehttp_is_sep'ehttp_is_lws?ehttp_is_sphtWehttp_is_crlfoehttp_is_tokenehttp_is_ver_tokeneHTTP_200 fhttp_200_chunkfHTTP_3011fHTTP_302CfHTTP_303UfHTTP_401_fmtwfhttp_err_codesfhttp_err_chunksfhdr_encode_mapfurl_encode_map ghttp_methodswgsess_cookiegsess_set_cookie00(splice(stream_sock_shutr#)stream_sock_readd+stream_sock_shutw+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv .stream_sock_chk_snd(`,&appsession_task_init'appsession_init:(appsession_refresh6)match_str)destroy)appsession_cleanupx+pool2_appsess+apools+have_appsessionI=P ,recalc_server_map-init_server_mapr0fwrr_init_server_groups6fwlc_init_server_tree[7get_server_ph7get_server_ph_post9get_server_hh9assign_servermAassign_server_address&Bassign_server_and_queueiBconnect_serverGEsrv_redispatch_connectFbe_downtimeFbackend_parse_balancew'$stream_int_check_timeouts%stream_int_report_error@%stream_int_return%stream_int_retnclose5:-print_csv_headerx-stats_dump_proxy.stats_dump_http/stats_dump_rawc0stats_dump_raw_to_buffer0stats_dump_sess_to_buffer1stats_dump_errors_to_bufferJ: 7,tcpv4_bind_socket#.tcp_bind_listener/tcpv4_add_listener@/tcpv6_add_listenerg/tcp_inspect_request%UqF52'sess_change_serverg'session_free{(init_session(session_process_counters(sess_update_st_con_tcpz)sess_update_st_cer'*sess_establish*sess_update_stream_int,sess_set_term_flags,process_session3default_srv_error4pool2_session4sessionsAhdr_idx_add&(%signal_initm%signal_handler%signal_register%__signal_process_queue&signal_queue_len&signal_state&signal_queue&blocked_sig`<3+acl_parse_nothingy+acl_fetch_nothing+acl_match_nothing,acl_match_str_,acl_match_reg,acl_match_beg-acl_match_endF-acl_match_sub.acl_match_dir.acl_match_dom.acl_match_int3/acl_match_ip~/acl_parse_str/acl_parse_reg]0acl_parse_intM2acl_parse_dotted_ver94acl_parse_ip4acl_register_keywords4acl_unregister_keywords4find_acl_by_nameP5find_acl_kwQ6parse_acl_expr27prune_acl7parse_acl8find_acl_default8prune_acl_cond@9parse_acl_condY:acl_exec_condi;cond_find_require<filt_cap<default_acl_listr '$create_pool'%pool_gc2%pool_refill_alloc%pool_flush2%pool_destroy26&dump_poolsIGread_freq_ctrifreq_ctr_remainnext_event_delay.Pfeb_deleteeb_insert_dupcBV[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)^-check_cttproxy_versionHOO__udivdi3`O__umoddi3r6P0y 07i  "0{ #[2-y &tk 5int 60 >Em ?ER AE3 C Di; GP7ro S UH  09 &-<5 &-?'#!' #' #b ' #  '#'#A'# '#z'# '#$'#(+ '#,M'#00'$#4.'#8Z'#<'#@'">#D '#{#FH'$*#Gb'(:#H'1#L'7/#Td'8/#X':#\"'<@#` / ' ' '#  '$# B '#< :  P 3oBTGQqFz #D #E# #F# $[ >   # #  + R # J # t +# ; wgy 6 7#w 8#2>40YgG ro  b# ڰ# }# n ܓ# " # 7 =%kC%t %v# %x#hnh#ph#C"  - C#ref!h#0]4!w !x# !yC# !z0# !{0# '!|0# r!}0# n9!~0# ?!0# -!0#$ 4!0#( @ c bc# ss @ H#s#s# bit#u32"0* +y#key,#r H0wq1#rq2# 3#0 4#4 50#8 6#< 7/#@ 8#Dr)  D# # # [# C#: D# #)8)J )K0# * )L0# {)M/#fd)N# ?)O0#exp)P0# y5)Q# 6)R# e5)S# 6)T#$ib)UJ #(ob)UJ #, x )V0#0 )W/#4J # )U ?"}0#rex"~#wex"#rto"# wto"#cto"#l"0#r"#w"# lr"#$ >"0#( "0#, "0#0 "0#4 H"#8 )"A #< "7#@ "7#A "b#D <"#L "#P "M #T "S #X y 0"tstr"u#len"v#  J  A p "z *C# L*C# *# !*#fe* #be* # *# ?*#$ Z *0#( D*#,req*J #0rep*J #4si*"#8 *# $*# *#srv*V# p*V# Q *V# > *"#txn*# *# * # *"# 2*"# # *Â# *Ă# ,*؎"# *0#y G d ] Tn  # ! # k auid ^f#gid _P#  `[# bux a  ! Lfd M# N# h O# `? P# Q#  R# $ S#  T0#  U#  VC# * W# A X# ' Y# ` Z/# [0#  b # ) c# T Q 4 m#  n# S o#  p# q# r#  s#$ ?5 t#( V6 u#,  v#0  w#4 { x#8 @ y#< h zC#@ e {#H  |C#L    FCfA#bBJ #.(?cbC# {D/# E7#evF7# G # H# I# J$#$ % $ J n9#get#put# u# # N<_ ``/# @a##setb##clrc## Ad## @e##remf5#clog5# T5hR# 9ih#$ Bjz#( P%kh#, Hlh#0 4m#4 n#8  5)LL*;hLXzLn a ^/# _%# k`%#ae+ ,# - # .# /#  =P h# O#II=5-8len-90#cr-:0#-;0#b -Cv-D# n9-E# -F# #*-G# 3-H# U0,    D ,,l,ޔ#m_l,ߔ#u,#u_l,# v,#v_l,#,l,#v_l,#c,#c_l,# r,#r_l,#,rq,;st,D, P ,0#sol,#eol,#som,0# col,0#sov,0#eoh,0#cap,#sl,# ,b#8  ,#@J, 3,0# b,# ,P #req,#rsp,#\uri,# ,# ,# I,# ?,0#yF  &0# f 0# 0# g VI@I JV# K# * L# M# N# O# B P# (R # S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< XC#@ !Y#H `?[#L p\#\ ?^#l `#| oa# b$# @dV# dV# e# o f# wg# h# i# ;i# $j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hwV# yt# yt# jz0# {q# }t# }t# ~t# ~t# t# .J# 0# t# t# t# Qt# U# (tDR # # O# # h# r# # # B$#,aclC#0 C#8 C#@ C#H >C#P >%#XsrvV#d e #h ? #l h ȶ%#p K# Z # ̔# # Δ# 0# Д# gє# [# Ӕ# R Ԕ# # ֔# ה# # G # Rڔ# 7۔# -'# # /ޔ# C# '&#id# +# C# t# 4 # # 0# i0# 0# 0# J# 0# +J# 0# t# t# t# $0# 0# `0# # z# # # # # 8# #0#j0# q#t#t#t#t# t#t#) t# t#Q t# #cap #p #?##o# #m ##u ##J{#{#### # #g##B#p ###Z#1(#]1(# # !#O"#q#7(# #7(#$#w %#&#'G(#= (#)# *0# +0#F,r$#:,r$#H\H ; + + C# +! #srv+"V# !D* *# *|# *|# /*|# *# *#  *#$ f&*[#( } *[#, *[#0 *t#4 Q*t#<"*px*ǰ #sv*V# *ɂ# D*ɂ# ?*0# iid*˔# J*˔#sid*˔#2" * "*n#"*iid*є#px*Ұ #buf*0#sid*0# ptr*Ք#bol*֔#"*!(*̤!!*"!*2" "  " "" "I"W#acl$*$+C#4$,#tC$-C#  $.#$/0#"#C$>$?C#g$@C#pol$A#$B0#p.$C##p7!`?4un5d in6#p2u7##r$x , H#t0H#t1H# 9 #  # # D#$ #($ |#len0#pos0# sid0#srvV#oe #src#bufS #%be !43%  !0# .C#f% srvf%# # #V%Xact##bck##,%actH#bckH#& # Q # # # # # 8 # V#map3%# l%#, V‘%# T ñ&# 7ı&# 9ű&# /Ʊ&# DZ&#&V&0'  # 3# T9# G;# I@# *# \# !#'-( 7(# &)# *# +# ++# 6,# ?-# -.)# /)# 0'#$0'1(!   1(# 4 # Z #len # \ !# E "#' G( W(P #y(5$3 $44(@/0C#D1(#be5W(# ]#N)x(=>C#D?(# J@# A#%B##C#?D0#E# F#$)   )# # #N))  )# # G#) *.S C.O# .P# h.Q# .R# + .;uid.<#gid.=# .># $.?# ,.@#  .A# !.B# a.C# .D# |.E#$ .F#( <.G#, .H#0 .I#4 +.I#8 J.J#< .J#@ .K#D .K#H .L#L  .L#P m .M##T u .M## .S)# .T # Y.U#% PnU&+{pU'+(+)+C*__cB+,(U,4+-, U-sig.T, U-sig.|,  )U/sig., 0RU/sig0p V10sVS.,b?`pU/sig>..9pU2V2+W0iS3p3'l4tmp3h3d5-3S6- 0__s/W5-`0ret'W5-0curV P3 WV3WS7&..cq(.'.cq(.(.( /7Z..(.'.(.(.( /7../5(.'./5(.(.( /'.NT(.'.NT(.(.( /8.n9m8/ -9+9x+9,.l11U0p W0p0 P0h1(S3 E1(V0sVV3cVp0lP3S3D(S3/ (V0expS3P0aclW#S3W#V3Jl1S3B l1V0rdrr1S3Cr1V0uap'V0ua'l3C")S0iS5o0:\h50:\h50:\h50:\h50:\h71x1(1'1(1'1(1'1;1P7211;;1Q'1r(2'2}(+2'1}(1y((<1"*t<1*t<1*t=1]>\1=1*tǂ<2 ~*t}<52 v*tu?g2 իU/sigV0pS@2 ]U3tA2BAC3M'`U22+ 0errV3}S3'`33\5.3 0w|h5a380px S0retP3 V5y3X0ret>P1x3jP1D[&3DJ &3DL&3D(L33 D(M3D4DD  D q*D.v!4FDwD xD .\ _4E D/QN4F(I D0;D0<D1;0Gnow1<|D1>|DZ %H s * H5nIpidoHXp4Dh.]HS  H& IoneHe5 ;H  5 H|5 D5 2#D 3$D4#Dj 5DD Q0DR0D U0D VDW1JlJ[m7(JJJnȯQN '0y 07i 2-kint7rn#p#) D}#}#h#E# #:<P #N# H H< 0CU ptr}Q h0S 'hPU[%S&NP i(hQ 4ٳU[3Vp 3HS idx50P ~<~7U[;RD;}W idx=0P!>HS&C%C% J@U[Ipp IHW idxK0P!LHSp&R%R%\S['U[ZW i\0V!]HS\g) M00OyF0MUinQT>VoutS/4intr @7 <` D ùP0y7i "%2-y&^kint6%>:m?:RA:3CDS7rH %9 -5 -? s#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. s#8Z s#< #@ "3#D #e#FH $#Gb (#H 1#L 7#Td 8#X :s#\" <#`    #  # B s#    3-n-#p-#o BT G Q$[3  _# #   R_# Jz# t#  w    b  #  m   # # # bit s#u32"%* +##key,m# H0wq1x#rq2x# 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,)8J K%# * L%# {M#fdNs# ?O%#expP%# y5Q# 6R# e5S# 6T#$ibUg#(obUg#, x V%#0 W#48g# U ?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )#< ,#@ ,#A L#D <#L #P #T #X~~gp m ] auid^I#gid_3# `># buxa!LfdMs# Ns# hOs# `?P# Q # Rs# $Ss# T%# U # V# *W # AX2# 'Y # `Z# [%# b# )c# TQ 4m # ns# Sos# ps# q_# rT# ss#$ ?5t #( V6u #, v/ #0 w/ #4 {x/ #8 @y/ #< hz#@ e{s#H |#L ss s  / s  V  Cf A #b Bg# .( ?cb C # { D# E,#ev F,# G #  HT#  Is# J #$ 5 j   N< _ ` `# @ a #set b #clr c # A d # @ e #rem f #clo g # T5 h # 9 i1 #$ B jC #( P% k1 #, H l1 #0 4 m#4  ns#8 s s s      s  1 s ! C  7 n 'PU! S /ӶU!. S >sU = P!? S \Ls ]U K P!M S( *Zs`U!Y S^ jsU i P!k S Lx=U!w Q !\|- @cU  P pU  R"v!\-) sӸU  S#errsV_s#U  S#errsVrs0sU  S#errsV7sùU  S#errsV$[ $J $ q $. vV $ ws )% $Q8й0ly 07inti 2-k7r  #>#}# #>#G}#-('7(>#&)}#*}#+}# ++}#6,>#?->#-.#/# 0#$< йU  <V uS 7 4O 2  '%%%}Pp '*%*}P@U  ?<uri?}S uASB}V 7C> S Q\ |U  [< [} u]S^}V ls jgZuU  < >P uɝRv<U  u<W 4u}P uwSkx}V  "]@̼U  <W +}P uS-}V  dмU  < >P uR&\U  < f} uםW}V V%> >-SB&p Qa 7U  &% %U <}VuWH }V{ S pout'%#0?&%%390!y #07u Bi "02-y&tk2B5int60>Pm?PRAP3CDi7roS UH 02I40Y1G <xo bR#w "7 $Po BT G QqFz %D%E#%F#P 7  J G#  #A J$$[I_ +#_# o R+#J#t#  w+#G#n ]#" # B d r\ s#R t # u# v#  w #6Tn  +#!#  k 9 -L5 - ?# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .#8 Z#< #@ "I#D #{#F H$#G b(#H 1#L 7/#T d8/#X :#\ "<#`/ # #B #Y  R  3 b#  E  # # # bit#u32"0y*+#key,E#n#p#y" - y#ref!#H H0wq1P#rq2P# 3#04#450#86^#< 7/#@8#DXXXH]4$w $xL#$yy#$z0#  ${0#'$|0#r$}0#n9$~0#?$0# -$0#$4$#(  )8J K0#* L0#{M/#fdN# ?O0#expP0#y5Q#6R#e5S# 6T#$ibU< #(obU< #,x V0#0W/#4 < # U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)3 #< B#@B#Ab#D<#L #P? #TE #Xk 0tstru#lenv#| | <  3 p zy#Ly# X#!#fe#be## ?#$Z 0#(D#,req< #0rep< #4si!#8 o#$o##srv^#p^#Q ^#> !#txn# ##!#2!## Í#č#,ؖ!#0#k 9 V ] auid^#gid_#`# buxaV  !LfdM# N#hO#`?Po#  Q#R#$S# T0#U#Vy#*W#AX^#'Y#`Z/# [0#b #)c# TQ4m#n#So#p# q+# r # s#$?5t#(V6u#,v#0w#4{x#8@y#<hzy#@e{#H|y#L     CfA#bB< #z.(?cbCz#{D/# EB#evFB# Gd#H #I#  J#$   Jn9#get#put#u# # p 7`? 46un 5jin 6$p 2u 7#w) D###[# y#:$d  "a"^/#"_%#k"`%#"a e!+!, #!-#!.#!/#  EP #W#QQwE5(8len(90#cr(:0#(;0#b (Cv(D#n9(E#(F##*(G#3(H# ]8'           D ' 'l'ޟ#m_l'ߟ#u'#u_l'# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'Cst'D'P '0#sol'#eol'#som'0# col'0#sov'0#eoh'0#cap' #sl'#  'b#8 '#@R'3'8#b'# 'B #req'#rsp'#\uri'# '#'#I'#?'0#yF &0#f 0#0# 1!^I@IJ^# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<Xy#@!YX#H`?[#Lp\#\?^#l`#|oa# b#@d^#d^#e#o f#wg#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guP# v#hw^#yt#yt#jz0# {#}t#}t#~t#~t#t#.R# 0#t# t#t#Qt#U#(tDR# ]#O]# # h#r###B"#,acly#0y#8y#@y#H>y#P>##Xsrv^#de #h? #lh ##pK#Z #̟##Ο#0#П#gџ#[# ӟ#R ԟ##֟#ן##G #Rڟ#7۟#-E%##/ޟ#y#'$#id#+#y#t#4 ##0#i0#0#0# R#0#+R# 0#t#t# t#$0#0#`0#]#z]#]#]## #8## 0# j0# # t# t# t# t# t# t# ) t#  t# Q t#  #cap # p # ?# # o# # m  # u  # J{# {# # # #  # # g# # B# p  #  # # Z# Q%# ]Q%#  # !# O"# q#W%# #W%# $# w %# &# 'g%# = (# )# *0# +0# F,"# :,"#Hd; && y#&!| #srv&"^# D ## # /###  #$f&[#(} [#,[#0t#4Qt#< #!pxǸ#sv^#ɍ#Dɍ# ?0# iid˟# J˟#sid˟# :! "Τ# !iidџ#pxҸ#buf0#sid0# ptr՟#bol֟#!(̬ #!:! !  !| !!| !I"x ,#t0#t1#9### D#$ #("#len0#pos0# sid0#srv^#oe#srco#bufE ##be4 B# !0#.y# u# srvu## # #^ #Xact"#bck"#, #act#bck# $#Q # ## ##8 # ^#mapB## {##,V ##T $#7$#9$#/$#$#$^$ ?% #3#T9#G;# I@#*#\#!#-?%! K% g% w%B "%<U#n;[Q$# ; $n9;%pos=S"&, OU#dst+R#src+S$n9+Q&-V"z&PPgU#nObVW$# O$n9O&G+QS&Rp"&rpU#nq[R$# q $n9q#altqP"%'|%'U#str{S%su}j&~P'(__s/j"R'"U#sR"{'~0sU$4Q"'U$4Q"((U#strS%saжP%ret(W%cP&#ӟV)outs*a((__s/J(0IB(__u((__cՂ+((,=,(-(,=,),),).(Y_%__vIP'%he+)P (/(n0m/+) -0+0x+ 0,"*_(U#strW#lowP$P%sa`%ret(p1cS2l2V3out(*"*4__s/5 *606I6B4__u*4__c**1sep V+m*(IX,(-(IX,),),)-(X\,(-(X\,),),).*1__v!IP'1he+)P)7,A4CU8str39`?3, 9U3,:f:d1c6V1s6W2v7S1len8[P*+04__s>/5+>6>06>I6>B4__u>,4__c>*%,H4__s?/5 ,?6?06?I6?B4__u?,4__c?*],`1errId-(,);)P,).x,1heW+)P'+4__vN0]++7[-nP:U9`?mV8dstm,P2ol2oh1choQ1tmpp[-p1tppk-W1cpqd-F0?s(i0(j07.5pWU8url9Z 9`?(2S1cpV1retR2Q20p'@D4__vI7/\`U9G+Q9  9s8map/9|V'2R/ 7l/K0'U8s-l/;}/Q<=/R>/I0?sڣ(i07/>00YU8s8lenP-/13;0S; 0Q<=0R> 0<0?s?len(i0700`U8s8lenP-0df;0S;0Q<=0V=0R@0A00BsBlen4i04j04k07-1U8sS8lenQ1iV1jR4k71+U8s*V8len*S8ret*P1i,Q1j-R71l[(U8sZ8lenZ 8retZ1P1i\tVW1j]lt72(0U9 S8ret2P9020V20W2~0p200l2 0d'p1j0R072j9U8srcW8nP1lenS1retVC7 K33 IC L3 3 C M3C[ ?3CJ ?3C.v_3Cw 3 D"r3  3 E3 3 p l{@0y+06ri%7i 2-y&vkint3CDk76H H9 -r5 -?#! # #b  #  ##A# #z# #$#(+ #,M#00#4.#8Z#<#@"V#D #}#FH$#Gb(#H1#L7#Td8#X:#\"<#`x 6   #  # B # 6  6 3n#p#]4w x}# y# zH# {H# '|H# r}H# n9~H# ?H# -H#$ 4#( 6  $[ V   # # 6 )8J KH# * LH# {M#fdN# ?OH#expPH# y5Q# 6R# e5S# 6T#$ibUE#(obUE#, x VH#0 W#4E# U ?}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 H#4 H#8 )#< O#@ O#A d#D <#L #P #T #Xt0tstru#lenv#Ep t 6] Cf A#b BE#f.( ?cb Cf# { D# EO#ev FO# Gv#  H#  I# J#$ v  |@kU&pFUbuf%ESmsg%r len%Vmax'%2C2 buf EO bufOU EP:UbufDES 0DVmaxFi%2pCK0 k@UbjESposj endjstrjr!lWlenm * UbESpos endWstrrlen!p GUbEVpos strrlen!WW :.UchkV n9Sfmtr"#=$retP% [0{Uo pbEW gStol&[ &J  &. v & w 6' & Q & ;H(  p$ -y#>0y 07i "02-y&ikint60>Em?ERAE3CD^~7roS UH 0oBTGQqF uz !D !E# !F#+iu9 - /5 - ?~# ! #  # b  # # # A# # z# #$ #( + #, M~#0 0#4 .~#8 Z~#< #@ ">#D #p#F H$#G b(#H 1#L 7#T d8#X :~#\ "<#`5   ~  ~#  # B ~#G@3Vtm,w :x~# +y~# }z~# {~# I|~# ]}~# A~~# u~# ~# #$ /#([ >    a# #  R a# J # t #w2>40YG  3o  b # x a# # n # " x#7 b#   # # # bit~#u32"0 ?* +#key, # dnd#pd#? "  - ?#ref!d#  H0wq1#rq2# 3~#0 4~#4 50#8 6$#< 7#@ 8~#D ]4w x:# y?# z0# {0# '|0# r}0# n9~0# ?0# -0#$ 4#( )8#J #K0# * #L0# {#M#fd#N~# ?#O0#exp#P0# y5#Q# 6#R# e5#S# 6#T#$ib#U #(ob#U #, x #V0#0 #W#4 # #U ? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H ~#8 ) #< 7#@  7#A W#D < #L #P   #T #X 1 0 tstr u#len v~#B B  H  p  z "?# L"?# "# !"#fe"!#be"!# "~# ?"~#$ Z "0#( D"#,req" #0rep" #4si"##8 "# $"# "3#srv"-# p"-# Q "-# > "##txn"# "~# "!# "## 2"## # "w# "w# ,"e## "0#1   ] E Tn  a# !E #U k auid ^6#gid _ #  `+# bux aU ! Lfd M~# N~# h O~# `? P# Q#  R~# $ S~#  T0#  U#  V?# * W# A X$# ' Y# ` Z# [0#  b # ) c#  T Q 4 m#  n~# S o~#  p~# qa# rV#  s~#$ ?5 t#( V6 u#,  v#0  w#4 { x#8 @ y#< h z?#@ e {~#H  |?#L  ~~~~CfA#bB # y.(?cbCy# {D# E7#evF7# G# HV# I~# J#$l  J n9~#get~#put~# u~# X# ~p7`?4lun5 in63 .p2u7#o'S C'O~# 'P~# h'Q~# 'R~#  ';uid'<~#gid'=~# '>~# $'?~# ,'@~#  'A~# !'B~# a'C~# 'D~# |'E~#$ 'F~#( <'G#, 'H#0 'I#4 +'I#8 J'J~#< 'J~#@ 'K~#D 'K~#H 'L~#L  'L~#P m 'M#T u 'M# 'S.# 'T # Y'U~# @)  D# # ~# P# ?#:* a ^# _%# k`%#aQ e+ ,# -# .~# //#   P d#  #@ e5&8len&90#cr&:0#&;0# b &Cv&D# n9&Ew# &Fw# #*&Gw# 3&Hw# & %!!!! ! !!!! ! D %¼c%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq% st%c }D% P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%}#sl%# %W#8  %~#@ !% 3%# b%e# % #req%#rsp%#\uri%# %# %# I%~# ?%0# XyF  &0# f 0# 0#g"-I@ I  J-# K~# * L~#  M~#  N~# O# B P# ( R!#  S~#  T~#$ 5 T~#( $ U0#, 6 U0#0 t V~#4 4 V~#8 ' W~#<  X?#@ ! Y#H `? [3#L p \3#\ ? ^3#l  `~#| o a# b# @ d-#  d-#  e# o f3# w gw#  h~#  i~# ; i~# $ j~# j~# R j~#  k~#  l~# F m~#id o#  p0# b p0# q0#  r0# u s0# ? t0# V t0# g u# v!# h w-#  yi# yi# j z0# {A#  }i#  }i#  ~i#  ~i#  i# . !# 0#  i# i#  i# Q i# U ~#g!(tD R  # # O # ~# h ~# r ~#  ~#  3# B $#,acl ?#0  ?#8  ?#@  ?#H > ?#P > $#Xsrv -#d e ~#h ? ~#l h Ȕ%#p K # Z #  ~#  #  ~#  0#  ~# g ~# [ # ~# R ~#  #  ~#  ~#  # G # R ~# 7 ~# - '#  # / ~#  ?# ' &#id # + #  ?# t ~# 4 ~#  ~#  0# i 0#  0#  0# !#  0# + !# 0#  i#  i# i# $ 0#  0# ` 0#  # z #  #  #  # ~# 8 #  ~# 0# j 0# A#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p 3# ? 3#  ~# o #  !# m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p #  #  ~# Z ~#   '# ]  '#  K#  !K# O "K# q #&'# #&'#  $~# w %#  &~#  '6'# = (~#  )~#  *0# +0# F ,P$# : ,P$#H3 !; $ $ ?# $!B #srv$"-# {"D" "~# "L# "L# /"L# "# "#  "#$ f&"P#( } "P#, "P#0 "i#4 Q"i#<""px"LJ!#sv"-# "w# D"w# ?"0# iid"~# J"~#sid"~# # " ""j#e#"iid"~#px"҇!#buf"0#sid"0# ptr"~#bol"~##"("{"""" ##!#B ##B #I P$x ,  #t0 #t1 # 9 !#  !#  ~# D ~#$  ~#($  L#len 0#pos 0# sid 0#srv -#oe !#src #buf #$ be !4 % ! 0# . ?#D% srv D%# ~# ~#-o%X act ##bck ##,% act #bck #&  ~# Q ~# ~#  ~#  ~#  ~# 8 ~# -#map %#  J%#, V o%# T Ï&# 7 ď&# 9 ŏ&# / Ə&#  Ǐ&#&-&'  ~# 3 ~# T9 ~# G; ~# I@ ~# * ~# \ ~# ! ~#-'! '6' F' #'>U$fmt=/%&?'tm@H(')'D)'P*'"+now!'+tm!' A#/(mSU$fmtR/%&T'tmUH('+)'D)'P#n(gU$outfn(S$fmtf/ %&h,(v~U$levu/V-w~S.&&z%&z%, )~5U$fac/V-~S.(&&%&%#+@KU$p!V/~ /-/S%-~-~-&-+-u-~~-~P-l~-2+----~W-}~-eS0*-*+P- ~R-S1*2*+V22~P(5+m3F+.K'tm(')')'P+$+$+0+ 4R+~5*+6M,P@P>U7s?B S8pnA8feB!V8beC!~9D!2%E~W2E~~8errE~~2F~8tmG~:,')'~)'P16,>I;__vj>.;__vi><[n(pid'Z~<& '_-/?"-2-/?,"-T-/ ?1D-@v-5?6-r f-?7-j f-+"@0yy 07i "02-y&ik27int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz "D"E#"F#    b#  p  x### bit#u32"0'*+#key,#LnL#pL#'{" - '#ref!L#]4!w !x#!y'#!z0#  !{0#'!|0#r!}0#n9!~0#?!0# -!0#$4!#( * 02>40Y5G @|o bV#$[> ##  R#J#t#  wWڇ#K#n a#" W# g7 9 -r5 -? #! # #b #  # #A # #z #  #$ #(+ #,M C#00 I#4. #8Z #< #@ ">#D #p#FH $O#Gb (_#H 1#L 7#Td 8#X :#\" <e#` C  C# I#B # r _  u 3 H0wq1#rq2# 3#04#450#86#< 7#@8#Du)8 J K0#* L0#{ M#fd N# ? O0#exp P0#y5 Q#6 R#e5 S# 6 T#$ib U; #(ob U; #,x V0#0 W#4 ; #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) 2 #< 7#@ 7#A W#D< #L #P > #T D #Xj 0 tstr u#len v#{ { ;  2 p  z '#L '# #! #fe #be # # ? #$Z 0#(D #,req ; #0rep ; #4si #8 #$ # #srv a#p a#Q a#> #txn # # # #2 ## Â# Ă#, ؙ # 0#j 8 U ]~ Tn  #!~ # k auid^1#gid_#`&# buxa  !LfdM# N#hO#`?P#  Q #R#$S# T0#U #V'#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n#So#p# q# r|# s#$?5t #(V6u #,v#0w#4{x#8@y#<hz'#@e{#H|'#L       7 Cf A #b B; #.( ?cb C#{ D# E7#ev F7# G# H|# I#  J#$    Jn9#get#put#u# #t) D###P# '#:!{ a^#_%#k`%#ae+,#-#.#/*# BP L#T#NNtB5%8len%90#cr%:0#%;0#b %Cv%D#n9%E#%F##*%G#3%H# Z5$    D $$l$މ#m_l$߉#u$#u_l$# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$# $rq$@st$D$P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$۱#sl$#  $W#8 $#@U$3$5#b$# $A #req$ #rsp$ #\uri$# $#$#I$#?$0#yF &0#f 0#0# 5 aI@IJa# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X'#@!Y#H`?[#Lp\#\?^#l`#|oa# b#@da#da#e#o f#wg#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v#hwa#yi#yi#jz0# {<#}i#}i#~i#~i#i#.U# 0#i# i#i#Qi#U#(tDR # a#Oa# # h#r###BC"#,acl'#0'#8'#@'#H>'#P>a"#Xsrva#de #h? #lh  ##pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉##G #Rډ#7ۉ#-܉$##/މ#'#' $#id#+#'#t#4 ##0#i0#0#0# U#0#+U# 0#i#i# i#$0#0#`0#a#za#a#a## #8##0#j0# <#i#i#i#i# i#i#) i# i#Q i# # cap #p #?##o##m 1!#u 1!#Jp#p#### # #g##B#p ###Z#$#]$# # !#O"#q#$# #$#$#w %#&#'$#= (#)# *0# +0#F,!#:,!#Hgx; ## '##!{ #srv#"a# D  # G# G# / G# # #  #$f& P#(} P#, P#0 i#4Q i#<&  px ǻ#sv a# ɂ#D ɂ# ? 0# iid ˉ# J ˉ#sid ˉ#= " R#  iid щ#px һ#buf 0#sid 0# ptr Չ#bol ։#  !( ̯! & ! =   {   {  I1!p7!`?4un5U in6J!p2u7 !#!x ,x#t0x#t1x#9### D#$ #(C"G#len0#pos0# sid0#srva#oe#src#bufD #a"be!4" !0#.'#" srv"# # #a"XactJ!#bckJ!#, #actx#bckx###Q # ## ##8 # a#map"# "#,V"#T $#7$#9$#/$#$#$a#$ #3#T9#G;# I@#*#\#!#-$! $ $ $A "%GT@U# SS$%Sh%%$!%S\%.%&!% v'tu(:%])\:%*z%0dU+t/S,-5P"&{pU#z V- |W.eb}:%S/%&%&0&P/&&%'$'%$'$7'0I'P%U'/n&b'%s'$'%'12'P$7'0I'P%U'/&%%%$!%%.%/&'%%'0'P$'b%'%'&&5_'t1^'t2^&'7:%) 631'61'4 53b'1'4G+4F0&'C:%)B:%3'T1'4S1'5tU&'k)j'nowj&'h'tg'fg0"@)BU# .tS.eb:%V-0W-‰p/(b':%s'$':%'1:2'P$7'(70I'P%U'/(@):@%Q)$!%:@0.%P/([)%h)/(t)%)%)$& %'$' %$'$7' 0I'P%U'&[)'t(t)I) &)'t1't26n*TPU7*Vj5__s8)909>975__un*5__cw,05__s8T*909>975__ut*5__cw)&*:[*g:J *:. v*7: w *; :&Q*:';0#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# ?O%# expP%#y5Q4#6R4#e5S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P #T #X:p  ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    -h;Utv1,Qtv2,Shtv1tv2`{`@Utv`Sg mshQ/6hUtv15Qtv25R.htv1tv2-Ah`Utv1@Vtv2@W- ?KX*htv1)tv2)3K:`Utv1JVtv2JSl{  H!" 2[:tv1Ztv2Z/ J:tv1Itv2I"retK: U:Utv1TWtv2TS   #!"  a: ZUtv1`Stv2`R+G  h$" Pb i``Utvh`VghRinchPb nt    w`tvv`%gvincv drhUtvq`SgqVincqQ    - chtv`%ginc {`TUtv1zRtv2zPtvz`V     `tv1tv2tv`U W``Utv1Stv2Rtv`QA U mg s   u      V`tv1tv2tv` o`tvn` hUtv1Qtv2R    htv1tv2k h@Utv1Qtv2Rk '|   htv1tv2&u@UrhSh 'L'p'h(()b bt   Euau htv1tv2x`tvx`AUthSaQ)rv)p͓p)cnthl ' *[4F*J 4*.vT*wh x+ * Qg,&%$ , %$ ,%$ -nowx$ ,$ ,$   ,! 0y 07i 2-y &^kint3 C DS7rH  09 -a5 -?s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Zs#<z#@">#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`g   #  # B s#s  l  3[ >   # # + 2>)8 J K0# * L0# { M#fd Ns# ? O0#exp P0# y5 Q# 6 R# e5 S# 6 T#$ib Ue#(ob Ue#, x V0#0  W#46e#  U ? }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H s#8 ) #< 7#@  7#A L#D < #L #P  #T #X||ep k ]ssCfA#bBe#].(?cbC]# {D# E7#evF7# Gm# H# Is# J#$ m  J n9s#gets#puts# us# "#sN<_ ``# @a#setb#clrc# Ad# @e#remf#clog# T5h# 9i #$ Bj#( P%k #, Hl #0 4ma#4 ns#8ss ss s 1+qw& Ufd%sWq3?~QSU/f.#.sF4:U3ap5sV &8% 8%! As@UpBsQbpCV"D ZU#bp\p]sV$ lsUoutk pmsS%#*nsh%nsW%7ospbppl&s!U'[ 'J  (  ' (msĴ   ( $ (.= ȴ(s' ( s$ ( s$  ) 'Qy k - 000y7i  "%2-kint 6% >:m ?:R A:h7r % oBTGQz $  n $# p $# ]4w x# y# z%# {%# '|%# r}%# n9~%# ?%# -%#$ 4#(  23 4%YG  o  b#[3 T   # T#d  R # Jo# t#w   # # n # " #, )Tn  # !)#9k ap7 `?4+un5in6 zp2 u79# b#z ### bith#u32"% 1* +# key,#  H0 wq1# rq2# 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _#  `#  bux a ! L fd Mh# Nh# h Oh# `? Pd# Q#  Rh# $ Sh#  T%#  U#  V# * W# A X# ' Y$# ` Z# [%#  b# ) c#  T Q 4 m*#  nh# S oh#  ph# q # r#  sh#$ ?5 t#( V6 u#,  vJ#0  wJ#4 { xJ#8 @ yJ#< h z#@ e {h#H  |#Lhhh:Jh:S COh# Ph# hQh# Rh#  ; uidh# $?h# ,@h#  Ah# !Bh# aCh# Dh# |Eh#$ Fh#( <G#, H#0 I#4 +I#8 JJh#< Jh#@ Kh#D Kh#H Lh#L  Lh#P m Ma#T u Ma# SP# T# YUh# T   h# <!h# "h# #T #   &T 0Uret'T (p__p5S IFUpHT S VPUpUT R "dU !" X#2 ش*#T Դ#hд#h̴;' 30Wy 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz !D!E#!F#|  a^#_%#k`%#ae jh#hi#Lj?e+,?#-E#.#/v# K 2>40YPG [o bq#$[> ##  R#J#t# - wrڢ#f#n |#" r# 7 9 - 5 - ?# ! #  # b  # # # A# # z# #$ #( + #, Md#0 0j#4 .#8 Z#< #@ ">#D #p#F H$p#G b(#H 1#L 7#T d8#X :#\ "<#`d d# j#B #-  &  3 b#    # # # bit#u32"0M*+#key,#r n r#p r#M" - M#ref !r# H0wq1$#rq2$# 3#04#450#862#< 7#@8#D,,,]4 w x # yM# z0#  {0#' |0#r }0#n9 ~0#? 0# - 0#$4 #(  )8 J K0#* L0#{ M#fd N# ? O0#exp P0#y5 Q#6 R#e5 S# 6 T#$ib U #(ob U #,x V0#0 W#4 #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8)  #< 7#@ 7#A W#D< #L #P  #T  #X? 0 tstr u#len v#P P  V  p  z M#L M# ,#! #fe 7#be 7# # ? #$Z 0#(D #,req  #0rep  #4si ?!#8 #$ # -#srv #p #Q #> O!#txn 3# # z# a!#2 x!## w# w#, !# 0#?  * ]S Tn  #!S # c k auid^1#gid_#`&# buxac  !LfdM# N#hO#`?P#  Q#R#$S# T0#U#VM#*W#AX2#'Yp#`Z# [0#b #)c# TQ4m#n#So#p# q# r# s#$?5t#(V6u#,v#0w#4{x#8@y#<hzM#@e{#H|M#L      Cf A#b B #.( ?cb C#{ D# E7#ev F7# G# H# I#  J#$    Jn9#get#put#u# #p7`?4un5* in6-1p2u7#) D###P# M#:18P r##5$8len$90#cr$:0#$;0#fb $Cv$Df#n9$Ew#$Fw##*$Gw#3$Hw# #           D #l #l#މ#m_l#߉#u##u_l## v##v_l## j#l##v_l##c##c_l## r##r_l###rq#st#-D#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#-#sl#j#  #W#8 ##@#3##b## # #req##rsp##\uri## ####I##?#0#yF &0#f 0#0# P!I@IJ# K#* L#M# N# O#B P#(R7#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<XM#@!Y,#H`?[-#Lp\-#\?^-#l`#|oa# b#@d#d#e#o f-#wgw#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu$# v=#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#7(tDR# |#O|# # h#r##-#B~"#,aclM#0M#8M#@M#H>M#P>"#Xsrv#de #h? #lh D##pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉#ؕ#G #Rډ#7ۉ#-$##/މ#M#'E$#id#+#M#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#|#z|#|#|## #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p -# ?-# # o# 7# m # u # Jp# p# # # #  # # g# # B# p ?# ?# # Z# $# ]$#  # !# O"# q#$# #$# $# w %# &# '$# = (# )# *0# +0# F,"# :,"#Hz; "" M#"!P #srv""# + D  # G# G# / G# # #  #$f& P#(} P#, P#0 i#4Q i#<  px 7#sv # w#D w# ? 0# iid ˉ# J ˉ#sid ˉ# " x# ! iid щ#px 7#buf 0#sid 0# ptr Չ#bol ։#?! ( +  Ϣ  ׹ O! Ca!P U!x!P g!I"x ,#t0#t1#9=#=## D#$ #(~"G#len0#pos0# sid0#srv#oe7#src#buf #"be74 " !0#.M# " srv"# # # #Xact!#bck!#, D#act#bck# 3$#Q # ## ##8 # #map"# "#,V##T ?$#7?$#9?$#/?$#?$#?$3$ $ #3#T9#G;# I@#*#\#!#-$! $ $ $ "%U#dstW#src #strvV$%%p&}%P'len#S'num#P(%c/7Q%G/7P&%\f)52()53% " &nEv-U#strDvS'errFvV"{&;fv0U$bd{&S$dER$eR$evV*expg?+?O'errjvP?,7K&& >,L&& ~,M& & -&`' ,[&,J &,. v ', w 1'. ,%Q 'nP8 0y 07i  "0{ #[2! %m-y &k 5int 60 =b >Em ?E! @PR AE BE3 C Dt7ro S U l@ qH  09 *-s5 *-?+#!+ #+ #b + #  +#+#A+# +#z+# +#$+#(+ +#,M+`#00+f#4.+#8Z+#<+#@+">#D +##FH+$l#Gb+(|#H+1P#L+7f#Td+8f#X+:#\"+<#`  7 f +` + +`#  +f# B +#)s | "  3oBTGQqF$z $D $E$# $F/#2>40YG .o  b#$[[ >m  9# m# }   R9# J# t#  w  9# # n # "  # 7 rr \s# Rt# u# v# w#D% %3 %4# c%5# %6# %7# O %8# %9# !%:#,', !'-# " '.# !'/# '0# Q:!X)% !!)&# )'># !))# )-# R).# )/# )0# !)1# d)2>#( 8)4#, X)8:#0 H!);E#4 !)?$#8 !)@[#< )A$#@ ")B[#D )C$#H [)D[#L ")F[#P e)G[#Tt bt#  Q Y### bit#u32 "0 *  +#key ,#- n -#p -#\"  - #ref !-# H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7f#@  8#D\ ]4"w "x# "y# "z0# "{0# '"|0# r"}0# n9"~0# ?"0# -"0#$ 4" #(   j )8-J -K0# * -L0# {-Mf#fd-N# ?-O0#exp-P0# y5-Q| # 6-R| # e5-S| # 6-T| #$ib-U #(ob-U #, x -V0#0 -Wf#4v v  j  # -U ?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 #0#4 H##8 )# #< #7#@ #7#A #m#D <#v #L #v #P # #T # #X  0#tstr#u#len#v#     p #z .# L.# .# !.^#fe.D!#be.D!# .# ?.#$ Z .0#( D.#,req. #0rep. #4si.L##8 .}# $.}# .#srv.# p.# Q .# > .\##txn.@# .# .!# .n## 2.…## # .Í# .č# ,."## .0#  ]Tn  9# !#  kQ auid^#gid_# `#d buxak!LfdM# N# hO# `?P}# QX# R# $S# T0# U^# V# *Wt# AX# 'Yz# `Zf# [0# bQ# )c#X TQ 4m# n# So# p# q9# r.# s#$ ?5tt#( V6ut#, v#0 w#4 {x#8 @y#< hz#@ e{#H |#Lkdtd  XCfAt#bB #B.(?cbCB# {Df# E7#evF7# Gr# H.# I# J#$ R  J n9#get#put# u# #R )  D# # # [# #:G a ^f# _%# k`%#ae+ ,# -# .# /# R GP -# #(518len190#cr1:0#1;0#yb 1Cv1Dy# n91E# 1F# #*1G# 31H# 0    D 0&0l0ޟ#m_l0ߟ#u0#u_l0# v0#v_l0#}0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st0&@D0 P 00#sol0#eol0#som00# col00#sov00#eoh00#cap0#sl0}# 0m#8  0#@0 30# b0(# 0 #req0#rsp0#\uri0# 0# 0# I0# ?00#yF  &0# f 0# 0# $ I@I J# K# * L# M# N# O# B P# (RD!# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X#@ !Y#H `?[#L p\#\ ?^#l `#| oa# b# @d# d# e# o f# wg# h# i# ;i# $j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# vJ!# hw# y# y# jz0# {# }# }# ~# ~# # .# 0# # # # Q# U#$D!(tDR ^# # O# # h# r# # # B%#,acl#0 #8 #@ #H >#P >%#Xsrv#d e #h ? #l h P&#p K# Z # ̟# # Ο# 0# П# gџ# [# ӟ# R ԟ# # ֟# ן# ب# G # Rڟ# 7۟# -c(# # /ޟ# # 'Q'#id# +# # t# 4 # # 0# i0# 0# 0# # 0# +# 0# # # # $0# 0# `0# # z# # # # # 8# #0#j0# ##### ##) # #Q # #cap #p #?##o#D!#m x$#u x$#J##### # #g##B#p ###Z#(#](# # !#O"#q#(# #(#$#w %#&#'(#= (#)# *0# +0#F, %#:, %#HY!; / / # /! #srv/"# 8"D. .# .# .# /.# .# .#  .#$ f&.[#( } .[#, .[#0 .#4 Q.#<".px.D!#sv.# .ɍ# D.ɍ# ?.0# iid.˟# J.˟#sid.˟#" . ".3#"#.iid.џ#px.D!#buf.0#sid.0# ptr.՟#bol.֟#L#.!(.8"!.ϯ"!." \# P!n# b## v t#GI"#acl(*(+#4(,#tC(-#  (.#(/0##P$C(>(?#g(@#pol(A#(B0#p.(C#x$p7!`?4Dun5 in6$p2u7P$# %x , Y#t0Y#t1Y# 9J!# J!# # D#$ #(% #len0#pos0# sid0#srv#oeD!#src}#buf #%beD!!4%  !0# .#& srv&# # #+&Xact$#bck$#,P&actY#bckY#?' # Q # # # # # 8 # #map%# &#, V+&# T K'# 7K'# 9K'# /K'# K'#K'?''  # 3# T9# G;# I@# *# \# !#c(-( 7(# &)# *# +# ++# 6,# ?-# -.*# /$+# 0c(#$'(!  !(# 4!# Z!#len! # \!!# E!"#i( (  ( #)5$3D!$44M)@/0#D1M)#be5(# #)E 89#D:M)#*x(=>#D?M)# J@# A#%B##C#?D0#E# F#$J* &$ &%#kw&&# &-s*#s*D!D!J**&5 &6#kw&7*# ** *   *# # #*$+  $+# # G#*k+4S C4O# 4P# h4Q# 4R# , 4;uid4<#gid4=# 4># $4?# ,4@#  4A# !4B# a4C# 4D# |4E#$ 4F#( <4G#, 4H#0 4I#4 +4I#8 J4J#< 4J#@ 4K#D 4K#H 4L#L  4L#P m 4Mx$#T u 4Mx$# 4S*+# 4Td# Y4U#.-!U 4V#valW0#capX0# 'Y0# %. ^U&str~'3^V(l^P(cP)~)fS)0~)#S(endW*> <+.(ss}~,--D-__sf....//0//$//0//P15;(__v>P+.-__sf2(heI/P3/n4m3I/ -4+4x+4,5/ 6U6(D!V7capQ66p.7arg68msg S0///90)3:(2D!5Z0X  @qU6(D!P6 6p.7arg50-U6(,D!P6, 6p.,7arg,5 1 :U6(9D!P69 6p.97arg95b1"G1U6(FD!P6F 6p.F7argF51T@qU6(SD!P6S 6p.S7argS52_U6(^D!6^W6p.^V7arg^S5f2H"hhU6(gD!6gW6p.gV7arggS52ppU6(oD!6oW6p.oV7argoS5j:w U661! 6?7inv;~: U+:p?__sf0:/:@:9:(8D!5eʉU661! 6?7inv;mD!;!S8errP8rc}8val0~; ~JW=&t%=t%,1>_q=&u%=u%,{>=&~%=~%1=~;~P+>;KD!R0.//0//$//0// >=&%=%,P ??=&%=%,Qc?r?=&%=%,)Q@@=&%=%,OQ@ A=& %= %,jQA/B8sk |:Q,Q/B }8sk? |:V,cR!CCC=& %= %1!CCC= ; P+S; x$~; S,R^CkC=& %= %1CE;( V;( W+R 8skM |:R2 8skC :R,'SEF=&t %=t %,MSFF=& %= %,sS$F1F=& %= %,S5FAF=& %= %+S8 ; #S.S.GG//0/GG/$//0//P,WRR=& %= %1RR= ; P+WW ;K P0.RS//0/RS/$//0//,WTT?__v >,WqUU=& %= %,WUU=& %= %,#XUU=& %= %.WX.UU//0/UU/$//0// %=> %,EZ@XSX=&P %=P %.yZ.XX//0/XX/$//0//En=-ret?3^f9!f4!e46"e^f,5hC ЉU6;?!ho8fim;1!m;vm;m+]h 8argS8invm8endW;? im;p.V,zg=&Y%=Y%1=Y;YP,g%6=&_%=_%,gn=&d%=d%,g=&e%;e%S,h=&f%=f%,:h=&g%=g%1Ό=&h%=h%+wh ;9 m,h=&m%=m%1P;c7Q;G7P,hPZ=51]a=5 ih i @FkǜU;p p;mD!l;!W;hI,Lll I,MlI.vlIw lJ I2QlI  K(ID!KJL LI3;0Mnow3<I 4Xk+Ih4]I4^  m I 5m umI75I5I 6Q0I6R0I 6U0I 6VI6Wm n ~Lp!;n m /n/n  ,)]En n Zn/n )ykn  Jn))(!)c!y*f%b!/X0t"y 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0o BT G QqFez DE#F#k 2L40 YpG {o  b #$[L ##  =R#J#t=# M w  # ۆ#n ܜ#" # E 9 -@5 - ?># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 Z>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#`  # #B >#M  F  3   b #  9    #  #  # bit >#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H 0wq 1D#rq 2D# 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#n9~0#?0# -0#$4#(  )8J K0#* L0#{M#fdN># ?O0#expP0#y5Q#6R#e5S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U?}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P3 #T9 #X_ 0tstru#lenv>#p p 0 v ' p z m#L m# L#! #fe #be # ># ? >#$Z 0#(D #,req 0 #0rep 0 #4si #8 #$ # M#srv V#p V#Q V#> #txn # ># # #2 ## Å# ą#, ؎ # 0#_ - J ]s Tn  #!s # k auid^&#gid_#`# buxa  !LfdM># N>#hO>#`?P#  Q #R>#$S># T0#U #Vm#*W #AXR#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$?5t #(V6u #,v#0w#4{x#8@y#<hzm#@e{>#H|m#L   >> > >  ,CfA #bB0 #.(?cbC#{D# EE#evFE# G#H#I>#  J#$    Jn9>#get>#put>#u># #i) D##>#^# m#:X a^#_%#k`%#aze+,#-#.>#/e#   7P #I#CCi75#8len#90#cr#:0##;0#b #Cv#D#n9#E##F##*#G#3#H# O*"    D ""l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"5st"D"P "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ۦ#sl"#  "e#8 ">#@J"3"*#b"# "6 #req"#rsp"#\uri"# "#"#I">#?"0#yF &0#f 0#0# p VI@IJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xm#@!YL#H`?[M#Lp\M#\?^M#l`>#|oa# b#@dV#dV#e#o fM#wg#h>#i>#;i>#$j># j>#Rj>#k>#l>#Fm>#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#M#B8"#,aclm#0m#8m#@m#H>m#P>V"#XsrvV#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#-~$##/>#m#'##id#+#m#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p M# ?M# ># o# # m &!# u &!# J~# ~# ># ># >#  ># ># g># ># B># p # # ># Z># $# ]$#  t# !t# O"t# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H\; !! m#!!p #srv!"V# D  ># <# <# / <# 7# 7#  7#$f& ^#(} ^#, ^#0 w#4Q w#<  px ǰ#sv V# Ʌ#D Ʌ# ? 0# iid ># J >#sid >#2 " Θ#  iid >#px Ұ#buf 0#sid 0# ptr >#bol >#  !( ̤!  ! 2   p   p  I&!p7!`?4un5J in6M?!p2u7 #!x ,#t0#t1#9##># D>#$ >#(8"<#len0#pos0# sid0#srvV#oe#src#buf9 #V"be!4{" !0#.m#" srv"# ># >#V"Xact?!#bck?!#,"act#bck##>#Q ># >#># >#>#8 ># V#map{"# "#,V"#T ##7##9##/#####V#x$ >#3>#T9>#G;># I@>#*>#\>#!>#-x$! $ $ $6 "$g">JU#sVQ"$">PU#sVR$[ %$J  %$.v+%,$w> O%% $$Q>%&now%<<4E#\d06$y "07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez %D%E#%F#9 *-p5 *- ?+~# !+ # + # b + # +# +# A+# +# z+# +#$ +#( + +#, M+R#0 0+X#4 .+~#8 Z+~#< +#@ +">#D +#p#F H+$^#G b+(n#H +1#L +7#T d+8#X +:~#\ "+<t#`   +R ++R# +X#B +~#p n   3[ >   # #    R #J #t #  wFy 6  7~# w 8~#2>40YFG Qo bg#ڏ#\#n r#" # 7  b#  e  # # # bit~#u32"0*+#key,e#n#p#" - #ref!#h H0wq1p#rq2p# 3~#04~#450#86~#< 7#@8~#Dxxxh]4#w #x##y##z0#  #{0#'#|0#r#}0#n9#~0#?#0# -#0#$4##( - )8'J 'K0#* 'L0#{'M#fd'N~# ?'O0#exp'P0#y5'Q #6'R #e5'S # 6'T #$ib'U\ #(ob'U\ #,x 'V0#0'W#4-\ # 'U?$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#,$0#0 $0#4H$~#8)$S #< $7#@$7#A$W#D<$#L $#P$_ #T$e #X 0$tstr$u#len$v~#  \  S p $z&#L&# &x#!& #fe&#be&#&~# ?&~#$Z &0#(D&#,req&\ #0rep&\ #4si&'#8 &#$&#&#srv&p"#p&p"#Q &p"#> &'#txn&# &~#&%#&'#2&'## &w#&w#,&؈'#&0# Y v ] Tn  #! # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#`? P#  Q # R~#$ S~#  T0# U # V#* W#A X~#' Y #` Z# [0# b #) c# T Q4 m# n~#S o~# p~# q# r#  s~#$?5 t#(V6 u#, v1#0 w1#4{ x1#8@ y1#<h z#@e {~#H |#L  ~~ ~ ! 1~ !XCfA#bB\ #.(?cbC#{D# E7#evF7# G#H#I~#  J<#$ 7 < Jn9~#get~#put~#u~# d#!N<_``#@a;#setb;#clrc;# Ad;#@e;#remfM#clogM#T5hj# 9i#$Bj#(P%k#,Hl#04m#4n~#86~6~ ~!M6Add~BS~dpdp7`?4un5v in6p2u7#.SC.O~#.P~#h.Q~# .R~#  .;uid.<~#gid.=~#.>~#$.?~# ,.@~# .A~#!.B~#a.C~#.D~# |.E~#$ .F~#(<.G#,.H#0.I#4+.I#8J.J~#<.J~#@.K~#D.K~#H.L~#L .L~#Pm .M#Tu .M#.S# .T #Y.U~#5)8len)90#cr):0#);0#(b )Cv)D(#n9)Ew#)Fw##*)Gw#3)Hw# s(           D (.(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#,(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#I(rq(~st(D(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(#sl(,#  (W#8 (~#@(3(s#b(# (b #req(I#rsp(I#\uri(# (#(#I(~#?(0#) D##~#P# #:* !a!^#!_%#k!`%#!aze + ,z# -# .~# /# 5 *P ##I-(tD # r#O r# ~# h ~#r ~# ~# #B u##,acl #0 #8 #@ #H> #P> ##Xsrv p"#de ~#h? ~#lh ;$#pK #Z # ~# # ~# 0# ~#g ~#[ # ~#R ~# # ~# ~# ؋#G #R ~#7 ~#- ܻ%# #/ ~# ߙ#' <%#id #+ # #t ~#4 ~# ~# 0#i 0# 0# 0# -# 0#+ -# 0# i# i# i#$ 0# 0#` 0# r#z r# r# r# # ~#8 # ~# 0# j 0# 1#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p # ? #  ~# o #  # m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p z#  z#  ~# Z ~#  %# ] %#  #  !# O "# q #%# #%#  $~# w %#  &~#  '%# = (~#  )~#  *0# +0# F ,"# : ,"#HdyF &0#f 0#0# sF!;  #! #srv"p"# p"I@"Jp"# K~#* L~#M~# N~# O#B P#(R#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Yx#H`?[#Lp\#\?^#l`~#|oa# b<#@dp"#dp"#e#o f#wgw#h~#i~#;i~#$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gup# vv"#hwp"#yi#yi#jz0# {1#}i#}i#~i#~i#i#.-# 0#i# i#i#Qi#U~#"x ,  #t0 #t1 #9 v"# v"# ~# D ~#$  ~#(u#  <#len 0#pos 0# sid 0#srv p"#oe #src #buf e ## be 4 # ! 0#. ## srv ## ~# ~#p"$X act |"#bck |"#,;$ act #bck #*%  ~#Q ~# ~# ~#  ~# ~#8 ~# p"#map ##  ##,V $#T 6%#7 6%#9 6%#/ 6%# 6%#6%p"*%%  ~#3 ~#T9 ~#G; ~# I@ ~#* ~#\ ~#! ~#-%! % % %b &D& &~#&<# &<# /&<#&#&#  &#$f&&P#(} &P#,&P#0&i#4Q&i#<'&px&#sv&p"#&w#D&w# ?&0# iid&~# J&~#sid&~#,' &"&#'&iid&~#px&#buf&0#sid&0# ptr&~#bol&~#'&(&̞&&'&,' '- s' '' '">(-#2U#be1S$*(>(˝ѝ%O(&>(%O('[()3((2)(#>~ U#s=p"P*pc?'R+"?'V+"?'W+R#@~p,+C S&(ps-(S%(')hx.tgx.fg0))#[~=U#sZp"V+R#\~W,/b 0pc'$j))О-)P&(-(S%(')#;'.px;)) " *$v@U#sup"V*srvwp"S*msgxb h+R#y~W,+w#|~d"U*"6U#sp"V*srvp"S*msgb h+R#~W"*Z#@U#sp"S*srvp"S*msgb h+R#~W1*#U2sp"S3srv!p"S3msg"b h4R##~W5,&$~YU2fd~W6#6#6$#6"3txV3sp"S$z+(%(%(7+(3ret~P4w Q4~8oy9I#~8ov:__v0$",,%,-,,P;,P;,P;,;,7Q,x3sa86A:__v>&,%,% -&--&-P%1-<,"H~=sGp"># G9 #I~9 $J~9N>K~9"L, , '-O$W~.nowV~('V~'=-n#L~.nowK~('K~5-"~`U2fd~6#@3len~R3txh3sp"d&(;A%(%(?1"OxU2tNx4#P~3sQp"W3saRX3fdS~V3rvT~V6l$$L.1-1P-1R$h.1)%1%1$.1l-1Q-1$.1%1-1P$.--&-P%1-$.-ή-&-S-1-P$/1%1-1P$"/--&-P%1-$@/1-%1-1V7/9C$'~$s/--?-&-S%1-$/-?N-&-P%1-&1`v% 2%2@/:__v>704^$23ret~4?~8P4#~3srcH$O0%2%628;A2@k0!3__v>P&1E-1Q-1704^$2S3ret~P4?~&>(;M-O(P$0M2tw%Z2$ 1--&-P-1-P@]1"R9C$~$D1-"1-&-S%1-&11G% 2%2$v1>(Rd-O(P$11%1%1&--&-P%1-'1k~(j~.nowj~A1U/(f.<(#.~'2>#u~.t1t~.t2t~'M2#~(f<0ret~Ae2"T.fdS~BK3#~dU3pxp3sp"S:tx4I$~l4$~h4e$~d$3K3̷C\3,C\373;f3V&s3%3$73- -&-W-1-P&3s%3's3"x0txD0__p'3 7x.txA3I( xE[*3eEJ *3E qBE.v3XEw~ 4F E,Q3E-;0Gnow-<<E-=<E .XE.^e Gone.`6E.am4 H( IE Q0ER0E U0E VEW4p('5gp0$y 07inti  "02-y &wk 60 >Sm ?SR AS3 C7 Dl7ro S7 U7H  0oBTGQqFez DE#F#  n # p #e" - e# ref !#R]4w xR#ye#z0#  {0#'|0#r}0#n9~0#?0# -0#$4X#( h n 2L40YsG ~o b#$[ L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 %-C5 %- ?&># !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&#0 0&#4 .&>#8 Z&>#< &#@ &"L#D &#~#F H&$#G b&(#H &1#L &7#T d&8#X &:>#\ "&<#`& &&# &#B &>#J  C  3 b#  6  # # # bit>#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8"J "K0#* "L0#{"M# fd"N># ?"O0# exp"P0#y5"Q#6"R#e5"S# 6"T#$ ib"U0 #( ob"U0 #,x "V0#0"W#40 # "U?}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P3 #T9 #X_ 0t stru# lenv>#p p 0 v ' p z!e#L!e# !#!! # fe!# be!#!># ?!>#$Z !0#(D!#, req!0 #0 rep!0 #4 si! #8 ! #$! #!P# srv!V#p!V#Q !V#> ! # txn!# !>#!#! #2! ## !Å#!ą#,!؎ #!0#_ - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#`?P #  Q #R>#$S># T0#U #Ve#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$?5t #(V6u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    Jn9># get># put>#u># #i) D##>#^# e#: a^#_%#k`%#aze+,#-#.>#/h#   7P #I#CCi75$8len$90#cr$:0#$;0#b $C v$D#n9$E#$F##*$G#3$H# O*#    D ## l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#5st#D#P #0# sol## eol## som#0# col#0# sov#0# eoh#0# cap#ۦ# sl##  #e#8 #>#@J#3#*#b## #6 # req## rsp##\ uri## ####I#>#?#0#yF &0#f 0#0# s VI@IJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H`?[P#Lp\P#\?^P#l`>#|oa# b#@dV#dV#e#o fP#wg#h>#i>#;i>#$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B8"#, acle#0e#8e#@e#H>e#P>V"#X srvV#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#-~$##/>#e#'## id#+#e#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p P# ?P# ># o# # m &!# u &!# J~# ~# ># ># >#  ># ># g># ># B># p # # ># Z># $# ]$#  t# !t# O"t# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H\;   e# !p # srv "V# D! !>#!<# !<# /!<#!7#!7#  !7#$f&!^#(} !^#,!^#0!w#4Q!w#< ! px!ǰ# sv!V#!Ʌ#D!Ʌ# ?!0# iid!># J!># sid!>#2 !"!ΐ# ! iid!># px!Ұ# buf!0# sid!0# ptr!># bol!># !!(!̤!! !!2   p   p  I&!p7!`?4un5J in6P?!p2 u7 #!x ,# t0# t1#9##># D>#$ >#(8"<# len0# pos0# sid0# srvV# oe# src # buf9 #V"be!4{" !0#.e#"  srv"# ># >#V"X act?!# bck?!#," act# bck##>#Q ># >#># >#>#8 ># V# map{"# "#,V"#T ##7##9##/#####V#x$ >#3>#T9>#G;># I@>#*>#\>#!>#-x$! $ $ $6 "$t$'0pU#s&$S$max(0V%& $60$ '$>8U(R%$@U#p Q%FS&\"%$ap U#srv`VV#px`W$psb Q)ppb *cp S+%%ú,&+%&ۺ,"&-8&5.I&p.T&l/&$1 0s1$/-&#; 0px;-&3& \/`& >0tv1`&0tv2`&f& <(&$CU#sBVV$pDp*$E>W%л*Mp P-&.&S,&/&h0tg0fg0"A'$ U1p S)p 2$__pQ3[%N'3J %N'3.vn',3w> '4 3'Q'5now<<65 t' 3 Q03R03 U03 Vt3W'A6)l0[%y #07i "02-y&ikint60>Em?ERAE3CD^7roS UH 0oBTGQqFez %D%E#%F#9 +-p5 +- ?,~# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,j#0 0,p#4 .,~#8 Z,~#< ,#@ ,">#D ,#p#F H,$v#G b,(#H ,1#L ,7#T d,8#X ,:~#\ ",<#`    ,  ,j ,,j# ,p#B ,~#3p,3$[> ## "R#J#t"#2w^y6 7~# w8~#2>40Y^G io b#ڧ#t#n ܊#" #7 b#--}  # -# -# bit~#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5]4$w $x#$y#$z0#  ${0#'$|0#r$}0#n9$~0#?$0# -$0#$4$5#(E )8&J &K0#* &L0#{&M#fd&N~# ?&O0#exp&P0#y5&Q%#6&R%#e5&S%# 6&T%#$ib&Ut #(ob&Ut #,x &V0#0&W#4  Et # &U? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H ~#8) k #< 7#@ 7#A W#D< #L #P w #T } #X+ 0 tstr u#len v~#  t  k p  z #L # #! #fe J"#be J"# ~# ? ~#$Z 0#(D #,req t #0rep t #4si R$#8 #$ # #srv #p #Q #> b$#txn }# ~# "# t$#2 ‹$## w# w#, ($# 0# q  ] Tn  # ! # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#`?P#  Q#R~#$S~# T0#U#V#*W#AX#'Y##`Z# [0#b #)c# TQ4m)#n~#So~#p~# q# r# s~#$?5t#(V6u#,vI#0wI#4{xI#8@yI#<hz#@e{~#H|#L  ~ ~ ~9I~ 9pCfA#bBt #.(?cbC#{D# E7#evF7# G#H#I~#  JT#$OT Jn9~#get~#put~#u~# #9N<_``#@aS#setbS#clrcS# AdS#@eS#remfe#cloge#T5h# 9i#$Bj#(P%k#,Hl#04m#4n~#8N~ N ~ ~9 e NY | | ~Zk~ |  |p7`?4un5 in6p2u7#2-SC-O~#-P~#h-Q~# -R~#  -;uid-<~#gid-=~#->~#$-?~# ,-@~# -A~#!-B~#a-C~#-D~# |-E~#$ -F~#(<-G#,-H#0-I#4+-I#8J-J~#<-J~#@-K~#D-K~#H-L~#L -L~#Pm -M#Tu -M#-S# -T #Y-U~#) D##~#P# #:G "a"^#"_%#k"`%#"ae!+!,#!-#!.~#!/# R GP ##   yF &0#f 0#0#_5)8len)90#cr):0#);0#b )Cv)D#n9)Ew#)Fw##*)Gw#3)Hw#  (           D (¶](l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(]wD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(w#sl(#  (W#8 (~#@(3(#b(_# (z #req(#rsp(#\uri(# (#(#I(~#?(0#*^!I@IJ# K~#* L~#M~# N~# O#B P#(RJ"#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Y#H`?[#Lp\#\?^#l`~#|oa# bT#@d#d#e#o f#wgw#h~#i~#;i~#$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vP"#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#*J"(tDR# #O# ~# h~#r~#~##B%#,acl#0#8#@#H>#P>%#Xsrv#de ~#h? ~#lh P&#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#ب#G #R~#7~#-'##/~#߱#'Q'#id#+##t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p # ?# ~# o# J"# m # u # Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p # # ~# Z~# '# ]'#  # !# O"# q#'# #'# $~# w %# &~# ''# = (~# )~# *0# +0# F, %# :, %#H"; '' #'! #srv'"# >#D  ~# <# <# / <# # #  #$f& P#(} P#, P#0 i#4Q i#<# px J"#sv # w#D w# ? 0# iid ~# J ~#sid ~## " #($ iid ~#px J"#buf 0#sid 0# ptr ~#bol ~#R$ ( ># ϵ# #b$EV" t$ h$ $ z$ %x ,#t0#t1#9P"#P"#~# D~#$ ~#(%<#len0#pos0# sid0#srv#oeJ"#src#buf} #%beJ"4% !0#.#& srv&# ~# ~#+&Xact$#bck$#,P&act#bck#?'~#Q ~# ~#~# ~#~#8 ~# #map%# &#,V+&#T K'#7K'#9K'#/K'#K'# K' ?'' ~#3~#T9~#G;~# I@~#*~#\~#!~#-'! '' (z `(%*dow*~#h1*~#m1*~#h2*~ #m2*~#(*min*i#max*i#%*~#h%*~#(*`?*ϊ#U*Њ#(*i*~f*`(%*ѧ(%*())*ptr*str*reg*))G)%,**Ʊ#val*(#ptr*(#%*# len*~#$?*~#() *p*i*~ll*id*)a*)I)/*L%0*i*~#ptr*#len*~#?*~# ctx*)#*y%*kw*# **# %*I+# B*d+# *0# &* ~#*~  * #/)**~ J"  ~ * C+*C+ZB* *!#kw*"+#arg*%+# 1&*&~# p%*'#)*d+~ C+ *O++9&* *#kw*+#+/*!"+*%#str*$/*$,$/PU%s. S&Z0p',(#,)-,V)7,W*C,&.~+fd.~+sa.C,,U%.I,-S1 *@~PU%fd@~.lA}.pBJ"W/sC .txnDS1}/tE.cfdF~}&&G~}0d&05%0V&0%0n&}0 %]0&=0&'1E/8&`?P~&F%Q}1l-`.__pnV2-Y1^3j14x3j11-5t1}'1(12-1PW(12-1hr(12.1)1R(11(.6pnJ2~6snJ2}1o.6len\~P7O6pnl2}7 8__vs>1.6__pyR2.2(22.)2(621.6__pR2.2at(22.B2(O22/Z2(k2(t2'~2 O(2'1)1S(19x/@6pnb)~7*@8__vi>1/(6__pQ9/8__s1/@6__p"Q9/)98__s%1/X6__p+Q202q)2P7}329:06msgz }9X0U6msgz }9s0U.maxJ~P908__vU>108__vT>106pn:)~6sn:)~908__vE>48__vD>212(29(1:\2?12(2'2v(2}*1"/t;/__p*1 7+t<1E&F+feEJ"*1x1+tvx1<<1%1+ctr01+inc002-<)2%/+buf.t pxJ">l4 R>l7>dir~?tC*?P%C+Q=4& ~`U>pxJ">l4 P>l7>dir~?tC*?P%C+R93s~8__v >78__v >=s4%~<U>pxJ">l4 S>l7>dir~?tC*?P%C+V=5%%)~@U>px'J">l4' S>l7'>dir'~?tC(*?P%(C+V94[f8__v0>78__v.>=5~&:~U>px8J">l48 P>l78>dir8~?tC9*?P%9C+P@%PUA[+5eAJ +5A qZA.v5pAw~A x~A -\~6BA.Q5A;0Cnow<<A=<A -X2A-^} Cone-`NA-ax6 2A $Aj /A, /A Q0AR0A U0A VAW6D%Aj+3*-u0'y 07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez  D E# F# [ > p##  Rp#J#t#  w 2>40YG Mo b'#p##n 2#" # 7 9 !-@5 !- ?"~# !" # " # b " # "# "# A"# "# z"# "#$ "#( + "#, M"#0 0"#4 ."~#8 Z"~#< "#@ "">#D "#p#F H"$#G b"(#H "1#L "7#T d"8#X ":~#\ ""<#` " ""# "#B "~#M  F  3 b#  9  # # # bit~#u32"0m*+#key,9# n #p #m" - m#ref !#< H 0wq 1D#rq 2D# 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#n9~0#?0# -0#$4#(  )8#J #K0#* #L0#{#M#fd#N~# ?#O0#exp#P0#y5#Q#6#R#e5#S# 6#T#$ib#U0 #(ob#U0 #,x #V0#0#W#40 # #U?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P3 #T9 #X_ 0tstru#lenv~#p p 0 v ' p z$m#L$m# $L#!$ #fe$ #be$ #$~# ?$~#$Z $0#(D$#,req$0 #0rep$0 #4si$"#8 $#$$#$M#srv$#p$#Q $#> $"#txn$# $~#$I #$0"#2$G"## $w#$w#,$!#$0#_ - J ]s Tn  p#!s # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#`?P#  Q #R~#$S~# T0#U #Vm#*W #AXR#'Y #`Z# [0#b #)c# TQ4m #n~#So~#p~# qp# re# s~#$?5t #(V6u #,v#0w#4{x#8@y#<hzm#@e{~#H|m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#He#I~#  J#$   { Jn9~#get~#put~#u~# #N<_``#@a#setb#clrc# Ad#@e#remf!#clog!#T5h># 9iT#$Bjf#(P%kT#,HlT#04m#4n~#8 ~ ~ ~! 88~'T~8Df8Z) D##~#P# m#:lX a^#_%#k`%#aSe+,S#-Y#.~#/# _ P ##5'8len'90#cr':0#';0#5b 'Cv'D5#n9'Ew#'Fw##*'Gw#3'Hw# &    D &;&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#9&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#V&rq&st&D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&9#  &W#8 &~#@&3&#b&# &6 #req&V#rsp&V#\uri&# &#&#I&~#?&0#yF &0#f 0#0#  I@IJ# K~#* L~#M~# N~# O#B P#(R #S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H`?[M#Lp\M#\?^M#l`~#|oa# b#@d#d#e#o fM#wgw#h~#i~#;i~#$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v #hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~# (tDR # 2#O2# ~# h~#r~#~#M#B##,aclm#0m#8m#@m#H>m#P>##Xsrv#de ~#h? ~#lh T$#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#d#G #R~#7~#-%##/~#m#'U%#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#2#z2#2#2## ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p M# ?M# ~# o#  # m |"# u |"# Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p S# S# ~# Z~# %# ]%#  # !# O"# q#%# #%# $~# w %# &~# '%# = (~# )~# *0# +0# F,## :,##HI ; %% m#%!p #srv%"#  D$ $~#$<# $<# /$<#$#$#  $#$f&$P#(} $P#,$P#0$i#4Q$i#<q!$px$ #sv$Ȭ#$w#D$w# ?$0# iid$~# J$~#sid$~#! $"$Θ#!$iid$~#px$ #buf$0#sid$0# ptr$~#bol$~#"$!($ !$q!!$׈! "  0"p $"G"p 6"I|"p7!`?4{un5J in6M"p2u7T"##x ,#t0#t1#9 # #~# D~#$ ~#(#<#len0#pos0# sid0#srv#oe #src#buf9 ##be !4# !0#.m#$ srv$# ~# ~#/$Xact"#bck"#,T$act#bck#C%~#Q ~# ~#~# ~#~#8 ~# #map##  $#,V/$#T O%#7O%#9O%#/O%#O%#O%C%% ~#3~#T9~#G;~# I@~#*~#\~#!~#-%! % % &6 <& +$+%~#kw+&# +-e&#e&~~  ~<&&+5+6m#kw+7&# && &(SC(O~#(P~#h(Q~# (R~# a( (;uid(<~#gid(=~#(>~#$(?~# ,(@~# (A~#!(B~#a(C~#(D~# |(E~#$ (F~#(<(G#,(H#0(I#4+(I#8J(J~#<(J~#@(K~#D(K~#H(L~#L (L~#Pm (M|"#Tu (M|"#(S&# (T #Y(U~#"("'27U#cap1~R"('B@jU$B~R%=+'Y~pU$?W$W~ $(W $'X #errX$ X~&'Z0p&[~l'cap[~W'res\P&4\S'tv] h'td^ V())&c%)c%*))&g%)g%*))&g%)g%+)=+$*,N+* *)&l%)l%*D*)&p%)p%*h*$1)&t%)t%**5A)&t%)t%**ER)&y%)y%**Vb)&y%)y%**)&~%)~%*+)&%)%- )&%)%.Z+)3/(2 %,'~U$?S$~ $( $' #err$ ~&~l0cap~'resp)4'tv,W0td,'val0V(<,)&%)%*`,)&%)%+,,,,1,P,,2=+pv,N+03,'3P414x142~"-' U$4$~ #cap~W&m S&K p*X-(=)&%)%+o-=+`o,N+2=+or,N+5-' 4U647cap~V8m S8K W-9&%9%5r.'(@U7px(r.W64( 8#(*S8K*V-`u9&0%90%x. 5./R'H~QU6mG S+.=+ ,,N++.=+P\,N++.=+,N++/=+,N++/=+,N+2=+#),N+5/0'r~`U6>'q~8ms V8!t S8&u~W:erru~~8'v~~:msgw/~+/=+w,N+2=+,N+ / c;/0 U:p S2/0~1@0P1K0P.W0n#L~#u~__v>-mw>__v>?k'U@[!2@J !2@ q@.v3,@w~@ (\~ N3A @)Q=3B(( tB)~@*;0Cnow*<<@ (X&Bh'~' @(b~8'k&y80~0l*y 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz "D"E#"F#9 (-{5 (- ?)# !) # ) # b ) # )# )# A)# )# z)# )#$ )#( + )#, M)]#0 0)c#4 .)#8 Z)#< )#@ )">#D )#p#F H)$i#G b)(y#H )1#L )7#T d)8#X ):#\ ")<#`  )] ))]# )c#B )#&{ y   3 $[ >   # #   R #J #t # % wNTn  #!N# ^ k2>40Y^G io b#ښ#t#n ܊#" # 7  b# -- }  # -# -# bit#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D5]4!w !x#!y#!z0#  !{0#'!|0#r!}0#n9!~0#?!0# -!0#$4!5#( E )8#J #K0#* #L0#{#M#fd#N# ?#O0#exp#P0#y5#Q%#6#R%#e5#S%# 6#T%#$ib#Ut #(ob#Ut #,x #V0#0#W#4Et # #U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)k #< 7#@7#AW#D<#L #Pw #T} #X+ 0tstru#lenv#  t  k p z#L# #! #fe"#be"## ?#$Z 0#(D#,reqt #0rept #4si$#8 #$##srv#p#Q #> )$#txnD# #T"#;$#2R$## w#w#,##0# q ] auid^1#gid_#`&# buxa  !LfdM# N#hO#`?P#  Q #R#$S# T0#U #V#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n#So#p# q# r# s#$?5t #(V6u #,v#0w#4{x#8@y#<hz#@e{#H|#L       7CfA #bBt #.(?cbC#{D# E7#evF7# G#H#I#  J#$   Jn9#get#put#u# #N<_``#@a#setb#clrc# Ad#@e#remf,#clog,#T5hI# 9i_#$Bjq#(P%k_#,Hl_#04m#4n#8 , CC!2_COqCep7`?4un5%in6p2u7w#*SC*O#*P#h*Q# *R# w *;uid*<#gid*=#*>#$*?# ,*@# *A#!*B#a*C#*D# |*E#$ *F#(<*G#,*H#0*I#4+*I#8J*J#<*J#@*K#D*K#H*L#L *L#Pm *M#Tu *M#*S# *T #Y*U#) D###P# #:w a^#_%#k`%#a^e+,^#-d#.#/# j P ##yF &0#f 0#0#&5&8len&90#cr&:0#&;0#wb &Cv&Dw#n9&Ew#&Fw##*&Gw#3&Hw# %           D %}$%l%މ#m_l%߉#u%#u_l%# v%#v_l%#{%l%#v_l%#c%#c_l%# r%#r_l%#%rq%st%$>D%P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%>#sl%{#  %W#8 %#@%3%#b%&# %z #req%#rsp%#\uri%# %#%#I%#?%0# ^!I@IJ# K#* L#M# N# O#B P#(R"#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H`?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v"#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#"(tDR # #O# # h#r###BQ%#,acl#0#8#@#H>#P>o%#Xsrv#de #h? #lh &#pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉#o#G #Rډ#7ۉ#-ܗ'##/މ#߱#''#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# "# m # u # Jp# p# # # #  # # g# # B# p ^# ^# # Z# '# ]'#  # !# O"# q#'# #'# $# w %# &# ''# = (# )# *0# +0# F,$# :,$#HT"; $$ #$! #srv$"# #D #G# G# /G###  #$f&P#(} P#,P#0i#4Qi#<|#px"#svȷ#w#Dw# ?0# iidˉ# Jˉ#sidˉ## "##iidщ#px"#buf0#sid0# ptrՉ#bol։#$(#|#ד# )$E ";$ /$R$ A$$x ,#t0#t1#9"#"## D#$ #(Q%G#len0#pos0# sid0#srv#oe"#src#buf} #o%be"4% !0#.#% srv%# # #%XactX$#bckX$#,&act#bck#'#Q # ## ##8 # #map%# %#,V%#T '#7'#9'#/'#'#''' #3#T9#G;# I@#*#\#!#-'! ' ' 'z I"'?)5U#!4 Q$( )LTU# K R%!M S&errN'(V())*)+(')^',8)V,C),N),Y))0-d)_-o)-z)-)P-)W.).).)l.)')03()/')5*0! 1fd2)(k31j4uidj14gidj3j&5)l)5g)m)5`?n%6retp5 p74)7)7Q*7( )8)"T4fdS$`*Q)^`hU# ] P%!_ S'`*@(r*'*$,*~)P-*~-*V-*P/*}*$0!# 8*(315`?%5 ݉6ret݉9,*spBU:fds&lt ~1su 1tv&cfdw~%&x~;d&9;5%6;V&4;(2<,p%`?~%F%~<+&__pS++,7=*,)*,)-,W++,(-<+&__sP< ,0&__sP<$,H&__pR+;, -(--+,H-(U-=>\72,"6t?6__p2 - 74t8$-%/4buf.t 2H-h4tg4fg08_-4tǐ9/)CPU:sB #p.BQ%?D/&argEW@->&^%>^%@.>&_%>_%+#./$'(/,/P(/+F./NQ(/,/P(/@l.hu>&l%>l%@.}>&r%>r%@.>&v%>v%+./,8(/'0,8(0("0(.0+ //DS(/'0DS(0("0(.0+T//_n(/'0_n(0("0(.0+w//(/,/P(/'/(/'0(0("0(.0 / 8/)4s 4bt 3)k A0@i0hA;0 -0+0x+>0,9 1z(0U:s S:reqt V%p.W1p+0 1cv,1R,%1Q+011,>1P@0&__sW+0J1(W1'11(>1211k3j4nowj8J1(4buft 8c1)4buft 9^5p)0U:t&s p%*l%H*0h%*0W;)u;)x;4(<2>?0'^5(k5@A2%?0R'^5(k5+X2w5"(5+25 v(5(5+25 @,5R,5V'5@`,5R,5V+25(5,5S+25(5(5+35(5,5V)-5R+,3w5 (5+W35#J(5,5V)-5R@q3>?0+35(5+311&=(>1+311gs(>1+35~(5+35(6'6(*6+!446 (E6'O6(\6+`4n6 K(6'6K(6'O6%,\6P+w4H-Kr(U-+46(6+4 1',1P,%1Q+4 1,C,1P,%1Q+4 1Kb,1P,%1Q'6b(6+ 5 1o,1P,%1V+@5 1,1P,%1V' 1,1P,%1V8w5&4buft 85(*u4buftt 25>#u4t1t4t2t85U(c4bufbt 3@b05*(d085D(4buft 26"4t246 ~4t}2O6 v4tu8h6]3\h6264t264t86d(M4bLt B)UC7'K66 >C'L66 ~C'M6C[(7pCJ (7C q!C.vE77CwC xC *\ 7D C+Qr7C,;0Enow,Em?ERAE3CD^7roS UH 0oBTGQqF{z )D)E#)F#P37 3J3G# { #A3J9 /-V5 /- ?0# !0 # 0 # b 0 # 0# 0# A0# 0# z0# 0#$ 0#( + 0#, M0#0 00#4 .0#8 Z0#< 0#@ 0">#D 0#p#F H0$#G b0(#H 01#L 07$#T d08$#X 0:#\ "0<#`7b \$y$0 00# 0#B 0#    3tm,w:x#+y#}z#{# I|#]}#A~#u## #$\#($[> ##  !R#J#t!# 1 wVnV#pV#1" - 1#ref!V#]4(w (xm#(y1#(z0#  ({0#'(|0#r(}0#n9(~0#?(0# -(0#$4(#( . Q bQ# aa .  6# a# a# bit#u32"0*+g#key,#` H0wq1#rq2# 3#04#450#86v#< 7$#@8#Dppp`)  D # # # P#  1#: | D # #2>40Y G Po b*#ڦ##n 5#" # 7 s )8 J K0#* L0#{ M$#fd N# ? O0#exp P0#y5 Q #6 R #e5 S # 6 T #$ib U #(ob U #,x V0#0 W$#4  s  #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D<  #L  #P #T #X  0 tstr u#len v#     p  z 1#L 1# p#! g#fe ##be ## # ? #$Z 0#(D #,req #0rep #4si &#8 #$ # P#srv #p #Q #> &#txn # # =$# $&#2 ;&## Â# Ă#, %# 0#  ] Tn# # ##! # ' k Z auid^<#gid_&#`1#m buxa' t!LfdM# N#hO#`?P#  Qa#R#$S# T0#Ug#V1#*W}#AXv#'Y#`Z$# [0#bZ #)c#a TQ4m#n#So#p# q# r# s#$?5t}#(V6u}#,v#0w#4{x#8@y#<hz1#@e{#H|1#Ltm }m  a CfA}#bB #K.(?cbCK#{D$# E7#evF7# G[#H#I#  J#$ [  Jn9#get#put#u# #a   !!#!#!#3 !!3#!#G!#-(!'7!(#&!)#!*#!+# +!+#6!,#?!-#-!.#!/3# !0#$99! ''9#4'#Z'#len' # \'!#E'"#gp"7`?"4un"5 in"6Pp"2u"7?# 1SC1O#1P#h1Q# 1R# ? 1;uid1<#gid1=#1>#$1?# ,1@# 1A#!1B#a1C#1D# |1E#$ 1F#(<1G#,1H#01I#4+1I#8J1J#<1J#@1K#D1K#H1L#L 1L#Pm 1Mg#Tu 1Mg#1S# 1Tm #Y1U# r %a%^$#%_%#k%`%#%a?%e %j%h}#h%i}#L%je$+$,#$-#$.#$/\#   r7P V#I#CC7yF &0#f 0#0#5,8len,90#cr,:0#,;0#b ,Cv,D#n9,E#,F##*,G#3,H#  a+!!!! ! !!!! ! D + +l+ޔ#m_l+ߔ#u+#u_l+# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#7+rq+lst+D+P +0#sol+#eol+#som+0# col+0#sov+0#eoh+0#cap+#sl+#  +W#8 +#@+3+a#b+# + #req+7#rsp+7#\uri+# +#+#I+#?+0#.+ p.+\#idx+#val+# 7+#  "I@IJ# K#* L#M# N# O#B P#(R##S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X1#@!Yp#H`?[P#Lp\P#\?^P#l`#|oa# b#@d#d#e#o fP#wg#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v$#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.O# 0#i# i#i#Qi#U##(tDRg# 5#O5# # h#r##P#B:'#,acl1#01#81#@1#H>1#P>X'#Xsrv#de #h? #lh (#pK#Z #̔##Δ#0#Д#gє#[# Ӕ#R Ԕ##֔#ה##G #Rڔ#7۔#-##/ޔ#1#')#id#+#1#t#4 ##0#i0#0#0# O#0#+O# 0#i#i# i#$0#0#`0#5#z5#5#5## #8## 0# j0# G# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p P# ?P# # o# ## m g# u g# Jp# p# # # #  # # g# # B# p # # # Z# 9# ]9#  # !# O"# q#z)# #z)# $# w %# &# ')# = (# )# *0# +0# F,&# :,&#H6=$; ** 1#*! #srv*"# $D  # R# R# / R# # #  #$f& P#(} P#, P#0 i#4Q i#< e% px ##sv Ƞ# ɂ#D ɂ# ? 0# iid ˔# J ˔#sid ˔# |% " \# % iid є#px ##buf 0#sid 0# ptr Ք#bol ֔#& ( $ e% |% & $$& &;&  *&&x ,6#t06#t16#9$#$## D#$ #(:'R#len0#pos0# sid0#srv#oe##src#buf #X'be#4 }' !0#.1# ' srv'# # # 'XactA&#bckA&#, (act6#bck6# (#Q # ## ##8 # #map}'# '#,V'#T (#7(#9(#/(#(#(( z) #3#T9#G;# I@#*#\#!# ) ) #)5$3#$44)@/ 01# D1O*#be5)# O*C1 -?1# g-@1#pol-A# -B0# p.-C#)*E 8 91# D:O*#+x(= >1# D?O*# J@# A# %B# #C# ?D0# E# F#$t+%-dow-#h1-#m1-#h2- #m2-# +-min-i#max-i#%-˔#h%-̔# +-`?-5#U-5#,-i-Ȕf-t+%-ѻ+%-+=,-ptr-$str-reg-=,r,%,--1#val-+#ptr-,#%-s# len-ڔ#$?-۔#(, -p-$i-ll-id-,a-,I ,$ C-L%0-i-#ptr-#len-#?-# ctx-,#-y%-kw-\# --# %-].# B-x.# -0# &- #-g-C,--# $-W.-W.ZB- -!1#kw-".#arg-%.# 1&-&# p%-'1#,-x.W.-c..9&- -1#kw-.# .C-"#.-%%str-$C- /+3a#len# /# /b  /&/1ưU'iǔQ'tmpQ'msgɔS(t/)__s$*)__s$+/3rdU,bp ,msgp/W-bq/p- q\S.@sP/lens7+u0,pU,b R,msg/S-b/V- \,lenW.@P+0g3mU,hdr\,end\V-4\,lenW0val\R++1.\pU,s\P,e\S.u-V.-Q+1z0UU-4\,len ,sol\W,idx/R,ctx10eol\V0sov\S.0p141.#212Sn324!2pw3225!20<6;/5>262160/+2/ `U-4\S,sol\ ,idx/,ctx 17G3*<U,t S,si V,err-* -I,msgG3W23R38_3Q213k33x34383QM3 9k3+:buf 931:buf~ 93&:buf +35)3@U,s( S-3(Q ;,427aU,str6\p,len6l0m87P0h9,4S24 .;}4+PU,txnO}4P0ptrQQ0endQS<45H2U,s~ ,si~  0txn}4V0rdr h.1Q0lenS445$3A525K5+78X5Q3c54u5l359K5k/(:s'9o5%1:ctr0o5:inc00O95!&":ctr!o5<52U,s V,si S.x P~0hdrS26}7Y_87~87P27737372;77=s3737*=s> 8(U7/__vH>*  /__vG> }7?7"@now!7@tm!7 G571+:tv17:tv277 RA8JP@tv1I7@tv2I7/retKP<92h  U,somf,idxf/ ,capg-! g90eolip0solil0coliV0soviW.0jh0hk9S0lenld282! # 3228!2G N 322B0__p$Q+9&.\ hU,msg/V-/\W- 0S,ptr\R,end\Q-+-,9 1R- 1*  153 13I 10y 1051|-* 1M+ 0+:|/+\p9U,msg(/S-/(\ - )0P,ptr)\R,end)\Q-+*W-,*9 1-0=1*1/Fp1,O-14\1,/g11p11Q12^1-i<</@DU,buf ,msg/W,idx/. 0R0ptrS0endV1*`1-%1R-^1*M1 +13114D121-1#0135:1x+1+O14c1/1T3t1\1y1p1"1.102w<<"3<8<w 8<R2<<3<8<w 8<R2<<hk3<*> =9<;+F6E/:lenE:crE9=&"6!/C)e$- DU,t -#P0txn}4d.-`.C"\=l0.0V0hSD>0__s$W23>232DI>8/len82`>>3>2y>>8>Q2>>3?2>? 3?3(?31?BP0msgR h9>):buf 9>D(:buf 9?(:buf 9=?):s :b 6) +?3 P=U,s  S,req V0txn }4W2??j}8?P8?R473737BhE 8P5?k6j:nowj+3Al2 @U,s  ,req  0msg /W., PT.' i@0ctx X1/ (@.0 0PB/c B0hex 0R**5.5 P2@?Zn3?8?P2@>nt3>43Az8DAR8OAP4[A8lAP3wA5[AO$W:nowV6'V5An#L:nowK6'KF?I?3>4>I?L?3?2N<AB8<P*AB> =2NJPBB3WP8bPRDNEmPPDN0len| S(5O DD0eol9 V0sol9 h2!O21D6D324!2ODVD3222LO>BEHE3>2cO>HEKE3?2zO>)F/F3>2O>/F2F3?2O>FF3>2O>FF3?2O>GG3?2O>:H=H3>2P>HH3>2 PyPI!I3P3P47!I\I3737*!I\IE 8P9yPU(c:bufb 6@b0F*(d09PB-:buf 6n9+VG1PJHeU,s ,req  .0W/txn}40msg/.)5#.4VV11t S1, L1,V UDQ .DO*W.JWS=+1#DQ0retPB0retRB0rdr .,\R2Q WLL3W4K5LL8X5R3c5DRH.E0MS.F.MW.0M~.0N~.*N~.NP0valNP./O~42MM32DRh.J!WWDR0ret R4 WqPP3W4K5xPP8X5R3c52S WXQQ3W4K5_QkQ8X5R3c52HS W*RmR3W4K51R=R8X5R3c5D`S0retTR2|SyPUU3P3P2Sk3V9V8x3R2S>9V>V3>2S3A>VGV8DAQ8OAP2S[AfVnV8lAP3wA2T[AzVV8lAP3wAD T0len PVD[T.1\~.m-VB0qsPDT00lenS0pnVVDTH0lenV0pnVW(T[D\0eolS0solV2T2[[324!2[[322D%U`.DO*VB0retPD=U0__p$Q(YU\`].2SDU.P.F.S4<]^3<8<P8<R2Uu5^ _35DU0lenS0pn'W2U?__3?8?P2Vu5aa352*V>aa3>2dV3Aab8DAR8OAP4[Abb8lAP3wA2{Vu5&bCb35DV0ctx 2Vu5bb35B.3 i0ctx4 2V>ucxc3>4>d!d3>U**9!W& O:be N#) 7W -;W3PeeU- gS-E-W-1/len.3P;#XD4eeU,px#,l4  ,l7$R,dir-tC--P%W.Q.3P/txn}4;gX2fofU-P%W.Q-E-S=2;X.pffU- gS-E-V-1;GY 0fgU,px#,l4  ,l7$P,dir-tC--P%W.V/txn}40ptrR0lenQ;Y-  gygU,px#,l4  ,l7$P,dir-tC--P%W.V/txn }40ptr R0len Q;Z-,&ggU,px$#,l4$  ,l7$$R,dir$-tC%--P%%W.V/txn'}4/ptr(0len)P4Zgg8ZQ8ZS*ggEZR5Z<0:s\:len)i0;P[N.=g*hU,px;#,l4;  ,l7;$R,dir;-tC<--P%<W.Q/txn>}4;[0U0hhU,pxS#P,l4S V,l7S$R,dirS-tCT--P%TW.S/txnV}4;\\4uh&iU,pxs#P,l4s S,l7s$R,dirs-tCt--P%tW.V/txnv}4*hh/__v>;\40iiU,px#P,l4 R,l7$P,sol -tC-W-P%W.S/txn}40idx/Q0ctx1V;l]>,i%jU,px#V,l4 S,l7$Q,dir-tC-R-P%W.P/txn}4;]+0jojU,px#V,l4 S,l7$Q,dir-tC-R-P%W.P/txn}4;^1pjjU,px#P,l4 R,l7$P,sol -tC-W-P%W./txn}40idx/V0ctxX0cntS;_?/jkU,px#V,l4 S,l7$Q,dir-tC-R-P%W.P/txn}4;_1 k_kU,px#V,l4 S,l7$Q,dir-tC-R-P%W.P/txn}4;`-`k lU,px#P,l4 R,l7$P,sol -tC-W-P%W.V/txn}40idx/Q0ctx1S;`4+lUlU,px)#V,l4) S,l7)$Q,dir)-tC*-R-P%*W.P/txn,}4; a/->`llU,px<#V,l4< S,l7<$Q,dir<-tC=-R-P%=W.P/txn?}4;aM0PllmU,pxN#P,l4N p,l7N$P,solN -tCO-S-P%OW.V/txnQ}40idxR/Q0ctxS1WB0__s`$S#a`$`0$`>$`7/__u`a/__c`wa;{b-opmmU,pxm#V,l4m S,l7m$Q,dirm-tCn-R-P%nW.P/txnp}4;bM,mmU,px#V,l4 S,l7$Q,dir-tC-R-P%W.P/txn}4;c1ndnU,px#,l4  ,l7$P,dir-tC--P%W.S/txn}40ptrP0endVGr, pnnUH7.Kcc >H.Lcc H.McH[/cHJ /cH4 H H.v%dHwH 1\ VdI HQEdH;0JnowLm?LRAL3CDe7roS UH 7-oBTGQqFpz #D#E##F#9 '-{5 '- ?(%# !( # ( # b ( # (# (# A(# (# z(# (#$ (#( + (#, M(]#0 0(c#4 .(%#8 Z(%#< (#@ ("E#D (#w#F H($i#G b((y#H (1#L (7#T d(8#X (:%#\ "(<#`  (] ((]# (c#B (%#&{ y   3% %$[E ##   R#J#t # 0 w{Wڥ#ۺ#n #" #TnW  #! #2E47YG o b# >    b # .. ~    #  .#  .# bit %#u32 "7 * +4#key ,~# n #p #" - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 57#8 6#< 7#@ 8%#D6]4"w "x#"y#"z7#  "{7#'"|7#r"}7#n9"~7#?"7# -"7#$4"6#( F )8J K7#* L7#{M#fdN%# ?O7#expP7#y5Q&#6R&#e5S&# 6T&#$ibUu #(obUu #,x V7#0W#4  Fu # U?}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#,7#0 7#4H%#8)l #< >#@>#A^#D< #L  #P #T #X, 0tstru#lenv%#  u  l p z #L # #! #fe #be # %# ? %#$Z 7#(D #,req u #0rep u #4si &#8 #$ # 6#srv #p #Q #> !&#txn # %# L$# 3&#2 J&## ~# ~#, %# 7#  & %#<&!%# &"%#&# # r ] k auid^1#gid_#`&#$ buxa + !LfdM%# N%#hO%#`?P#  Q#R%#$S%# T7#U#V#*W4#AX#'Y#`Z# [7#b #)c# TQ4m:#n%#So%#p%# q# r# s%#$?5t4#(V6u4#,vZ#0wZ#4{xZ#8@yZ#<hz#@e{%#H|#L+ $ 4%%$ J Z%JCfA4#bBu #.(?cbC#{D# E>#evF># G0#H#I%#  J_#$ ` _ Jn9%#get%#put%#u%# # DN<_``#@aY#setbY#clrcY# AdY#@eY#remfk#clogk#T5h# 9i#$Bj#(P%k#,Hl#04m#4n%#8Y%%Dk_%eq%5%8len%97#cr%:7#%;7#Fb %Cv%DF#n9%E~#%F~##*%G~#3%H~# $    D $L$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#J$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#g$rq$st$ D$P $7#sol$#eol$#som$7# col$7#sov$7#eoh$7#cap$ #sl$J#  $^#8 $%#@$3$#b$# ${ #req$g#rsp$g#\uri$# $#$#I$%#?$7#) D##%#W# #:H !a!^#!_,#k!`,#!ae + ,# -# .%# /# S HP ##IK(tD# #O# %# h%#r%#%#6#B!#,acl#0#8#@#H>#P>!#Xsrv #de %#h? %#lh Ț"#pK#Z #%##%#7#%#g%#[# %#R %##%#%#ة#G #R%#7%#-$##/%#߲#'##id#+##t%#4 %#%#7#i7#7#7# K#7#+K# 7#p#p# p#$7#7#`7##z#### %#8#%# 7# j7# <# p# p# p# p# p# p# ) p#  p# Q p#  %#cap %# p 6# ?6# %# o# # m # u # Jw# w# %# %# %#  %# %# g%# %# B%# p # # %# Z%# &$# ]&$#  # !# O"# q#,$# #,$# $%# w %# &%# '<$# = (%# )%# *7# +7# F,V!# :,V!#HyF &7#f 7#7#p7`?4un5{in66p2u7#   ;  #! #srv" #  I@"J # K%#* L%#M%# N%# O#B P#(R#S%# T%#$5 T%#($U7#,6U7#0tV%#44 V%#8'W%#<X#@!Y#H`?[6#Lp\6#\?^6#l`%#|oa# b_#@d #d #e#o f6#wg~#h%#i%#;i%#$j%# j%#Rj%#k%#l%#Fm%#ido#p7#b p7#q7#r7#us7#?t7#Vt7#gu# v #hw #yp#yp#jz7# {<#}p#}p#~p#~p#p#.K# 7#p# p#p#Qp#U%# V!x ,#t0#t1#9 # #%# D%#$ %#(!G#len7#pos7# sid7#srv #oe#src#buf #!be4" !7#.#J" srvJ"# %# %# u"Xact #bck #,"act#bck##%#Q %# %#%# %#%#8 %#  #map"# P"#,Vu"#T Õ##7ĕ##9ŕ##/ƕ##Ǖ### #$ %#3%#T9%#G;%# I@%#*%#\%#!%#!-$!!  $ <$ L${ $D  %# G# G# / G# # #  #$f& W#(} W#, W#0 p#4Q p#<t% px #sv # ~#D ~# ? 7# iid %# J %#sid %#% " #% iid %#px #buf 7#sid 7# ptr %#bol %#& ( $ t% ׋% !&F 3& '&J&  9&&,SC,O%#,P%#h,Q%# ,R%# ( ,;uid,<%#gid,=%#,>%#$,?%# ,,@%# ,A%#!,B%#a,C%#,D%# |,E%#$ ,F%#(<,G#,,H#0,I#4+,I#8J,J%#<,J%#@,K%#D,K%#H,L%#L ,L%#Pm ,M#Tu ,M#,SP&# ,T$ #Y,U%#"(5L%nnU#e6L%S#5L(Q#%6L%R#+6L(V$lenL,W#?LWP%5LS&(36%n!qU'si p'bu S(6%l(%h)ret%Q)max%d*#)m520qqU'si1 S"*35%qjxU$fd%+si p+bu S+ret%Q+max%W%%l%\6%h%O5%d,"v,5xv,#s-)rr)fwd9%R.)((5%V/**t?t0*V1*/^**tu1*1*2@3*V3*Q4*4*3+V5+uv0%+R00+P5<+vv0M+P1X+6*h7tg7fg76+5h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6<+O$W%7nowV%:'V%6d+n#L%7nowK%:'K%*+5pxyU'si S;,J6x% y|U'fdw%)siy W)bzu S({%p,"z,#y,5y/:,+yy0%+R00+P5<+yy0M+P1X+/Q,,yy1,/o,* z+z0*S1*/,+zz0%+V00+R5<+zz0M+R1X+5*zz0*S1*6,D5D%:C%*-5M |}U'siL W)ibNu V)obOu S)fdP%p/h-+||0%+R00+P5<+||0M+P1X+/-+}}0%+R00+P5<+}}0M+P1X+5+R}g}0%+R00+P5<+a}e}0M+P1X+* .Y5}~U'si R)ibu P*8/6 ~wU'si V)obu S(%P,#2/o.,~~1,/.+#0%+W00+R5<+ 0M+R1X+/.*2Q0*S1*//+0%+R00+P5<+0M+P1X+5+0%+R00+P5<+0M+P1X+<['E/pEm ?ER AE3 C D^7ro S UH  09 -5 -? ~#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. ~#8Z ~#< #@ ">#D #p#FH $ #Gb (#H 1#L 7#Td 8#X :~#\" <#`     #  # B ~#   / 3qFcz D E# F#oBTGQ n #p #"  - #ref !#x]4w x# y# z0# {0# '|0# r}0# n9~0# ?0# -0#$ 4x#(   b#    ### bit~#u32"0?* +#key, # H0wq1#rq2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D?))  D# # ~# P# #:] D]# ]#P # #)2>40YG o  b# $[ >*   # *# : q R # J # t q#  w # ۺ# n # " # 7 )8!J !K0# * !L0# {!M#fd!N~# ?!O0#exp!P0# y5!Q# 6!R# e5!S# 6!T#$ib!U #(ob!U #, x !V0#0 !W#4 # !U ?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H~#8 ) #< 7#@ 7#A W#D <#L #P  #T  #X4 0tstru#lenv~#E E  K  p z "# L"# "# !"#fe" #be" # "~# ?"~#$ Z "0#( D"#,req" #0rep" #4si""#8 ":# $":# "#srv"# p"# Q "# > ""#txn"# "~# "#!# " ## 2"!## # "w# "w# ,"ؾ"# "0#4   ]H Tn  # !H # X k auid ^y#gid _c#  `n# bux aX  ! Lfd M~# N~# h O~# `? P:# Q#  R~# $ S~#  T0#  U#  V# * W# A X# ' Y# ` Z# [0#  b # ) c# T Q 4 m#  n~# S o~#  p~# q# r#  s~#$ ?5 t#( V6 u#,  v#0  w#4 { x#8 @ y#< h z#@ e {~#H  |#L  ~~~  ~CfA#bB #|.(?cbC|# {D# E7#evF7# G# H# I~# J#$   J n9~#get~#put~# u~# #p7`?4un5 in6,p2u7#m(S C(O~# (P~# h(Q~# (R~#  (;uid(<~#gid(=~# (>~# $(?~# ,(@~#  (A~# !(B~# a(C~# (D~# |(E~#$ (F~#( <(G#, (H#0 (I#4 +(I#8 J(J~#< (J~#@ (K~#D (K~#H (L~#L  (L~#P m (M#T u (M# (S,# (T # Y(U~# a ^# _%# k`%#ane+ ,n# -t# .~# /# )z 5%8len%90#cr%:0#%;0#b %Cv%D# n9%Ew# %Fw# #*%Gw# 3%Hw#  Z$!!!! ! !!!! ! D $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#0$rq$est$D$ P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$#sl$# $W#8  $~#@z$ 3$Z# b$# $ #req$0#rsp$0#\uri$# $# $# I$~# ?$0#yF  &0# f 0# 0# "I@I J# K~# * L~# M~# N~# O# B P# (R # S~# T~#$ 5 T~#( $U0#, 6U0#0 tV~#4 4 V~#8 'W~#< X#@ !Y#H `?[#L p\#\ ?^#l `~#| oa# b# @d# d# e# o f# wgw# h~# i~# ;i~# $j~# j~# Rj~# k~# l~# Fm~#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hw# yi# yi# jz0# {/# }i# }i# ~i# ~i# i# .z# 0# i# i# i# Qi# U~# (tDR # # O# ~# h~# r~# ~# # B'$#,acl#0 #8 #@ #H >#P >E$#Xsrv#d e ~#h ? ~#l h $#p K# Z # ~# # ~# 0# ~# g~# [# ~# R ~# # ~# ~# c# G # R~# 7~# -m&# # /~# ߋ# '%#id# +# # t~# 4 ~# ~# 0# i0# 0# 0# z# 0# +z# 0# i# i# i# $0# 0# `0# # z# # # # ~# 8# ~#0#j0# /#i#i#i#i# i#i#) i# i#Q i# ~#cap ~#p #?#~#o# #m #u #Jp#p#~#~#~# ~# ~#g~#~#B~#p n#n#~#Z~#y&#]y&# ]# !]#O"]#q#&# #&#$~#w %#&~#'&#= (~#)~# *0# +0#F,##:,##H#!; # # # #!E #srv#"# !D" "~# ":# ":# /":# "# "#  "#$ f&"P#( } "P#, "P#0 "i#4 Q"i#<K""px" #sv"Ȇ# "w# D"w# ?"0# iid"~# J"~#sid"~#b" " ""ζ#""iid"~#px" #buf"0#sid"0# ptr"~#bol"~#""("!"K""b" "   #E "!#E #I#x , #t0#t1# 9 #  # ~# D~#$ ~#('$ :#len0#pos0# sid0#srv#oe #src:#buf #E$be 4j$  !0# .#$ srv$# ~# ~#$Xact.##bck.##,$act#bck#% ~# Q ~# ~# ~# ~# ~# 8 ~# #mapj$# $#, V$# T %# 7%# 9%# /%# %#%%g&  ~# 3~# T9~# G;~# I@~# *~# \~# !~#-g&! s& & & #C'7W~NU$6X~%'C'߀&T''`&T'(&x)^'R*k'+|'%/'','P+'*' %+'-k'".t/.__p-' 70t-'n#L~0nowK~1'K~2'I1 #:(6#~PyU$6$~36%~4s&S4p' W5M$7/~V$6/~p#)6gʃU6tf4ph p$6i)l$6jS$*jW4ik~h%(),)P+*)%(')8,'P+'7(Y.lent~'3\}c-6)k~1j~0nowj~#)E~ЃU86P86P36365փ3&%3%9)MU86S9*{6PU4p S%x**ل+*%<**+***+***+***ل++*+ل+*+**,*P*4+ل,A+Q-*"0t-* ~0t}-* v0tu2*]1\*-+0t-4+0t2K+0t:[X+:J X+:LX+;4]) ;4) ;  ~) :.v+:w~ +< :&Q+:';0=now'<:: (Xm:(^ >(I : Q0:R0: U0: V]:W*$69P> 0:y !07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz $D$E#$F#9 +-{5 +- ?,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 Z,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7 6 B  , ,,# ,#B ,#I{B3$[> ## 8R#J#t8#Hwty6 7# w8#2>40YtG o b#ڽ#ۊ#n ܠ#" #73 b3#CC  # C# C# bit#u32"0*+I#key,#n#p#" - #ref!# H0wq1#rq2# 3#04#450#86#< 7#@8#D K]4"w "x*#"y#"z0#  "{0#'"|0#r"}0#n9"~0#?"0# -"0#$4"K#([ ))8&J &K0#* &L0#{&M#fd&N# ?&O0#exp&P0#y5&Q;#6&R;#e5&S;# 6&T;#$ib&U #(ob&U #,x &V0#0&W#4 5 5[) # &U?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#,#0#0 #0#4H##8)# #< #7#@#7#A#W#D<#5#L #5#P# #T# #XA 0#tstr#u#len#v#    p #z%#L%# %#!%#fe%"#be%"#%# ?%#$Z %0#(D%#,req% #0rep% #4si%$#8 %#$%#%#srv%P#p%P#Q %P#> %$#txn%# %#%"#%$#2%$## %w#%w#,%؈$#%0#   ] Tn  #! # k auid^1#gid_#`&## buxa * !LfdM# N#hO#`?P#  Q#R#$S# T0#U#V#*W3#AX#'Y9#`Z# [0#b #)c# TQ4m?#n#So#p# q# r# s#$?5t3#(V6u3#,v_#0w_#4{x_#8@y_#<hz#@e{#H|#L* # 3 #O_ OCfA3#bB #.(?cbC#{D# E7#evF7# G#H#I#  Jj#$ej Jn9#get#put#u# {#ON<_``#@ai#setbi#clrci# Adi#@ei#remf{#clog{#T5h# 9i#$Bj#(P%k#,Hl#04m#4n#8d d O { do   p   p7`?4un5 in6p2u7#H0SC0O#0P#h0Q# 0R#  0;uid0<#gid0=#0>#$0?# ,0@# 0A#!0B#a0C#0D# |0E#$ 0F#(<0G#,0H#00I#4+0I#8J0J#<0J#@0K#D0K#H0L#L 0L#Pm 0M#Tu 0M#0S# 0T# #Y0U#) D###P# #:] a ^# _%#k `%# a*e+,#-#.#/# h ]P ##  6yF &0#f 0#0#u5)8len)90#cr):0#);0#b )Cv)D#n9)Ew#)Fw##*)Gw#3)Hw# 6(           D (s(l(މ#m_l(߉#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(sD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(ۍ#sl(#  (W#8 (#@1(3(#b(u# ( #req(#rsp(#\uri(# (#(#I(#?(0#{.( p.(#idx(#val(# 7(# t!PI@ I JP# K#* L# M#  N# O#B P#( R"# S#  T#$5 T#($ U0#,6 U0#0t V#44 V#8' W#< X#@! Y#H`? [#Lp \#\? ^#l `#|o a# bj#@ dP# dP# e#o f#w gw# h# i#; i#$ j# j#R j# k# l#F m#id o# p0#b p0# q0# r0#u s0#? t0#V t0#g u# v"#h wP# yi# yi#j z0# {<# }i# }i# ~i# ~i# i#. # 0# i# i# i#Q i#U #"(tD R # #O # # h #r # # #B %#,acl #0 #8 #@ #H> #P> &#Xsrv P#de #h? #lh Ȱ&#pK #Z # ̉# # Ή# 0# Љ#g щ#[ # Ӊ#R ԉ# # ։# ׉# ؾ#G #R ډ#7 ۉ#- 0(# #/ މ# #' '#id #+ # #t #4 # # 0#i 0# 0# 0# # 0#+ # 0# i# i# i#$ 0# 0#` 0# #z # # # # #8 # # 0# j 0# <#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  #cap # p # ? #  # o #  "# m # u # J p#  p#  #  #  #  # # g #  # B # p #  #  # Z #  <(# ] <(#  $#  !$# O "$# q #B(# #B(#  $# w %#  &#  'R(# = (#  )#  *0# +0# F ,l%# : ,l%#HV"; '' #'! #srv'"P# #D% %#%G# %G# /%G#%#%#  %#$f&%P#(} %P#,%P#0%i#4Q%i#<$%px%Ǫ"#sv%P#%w#D%w# ?%0# iid%ˉ# J%ˉ#sid%ˉ#,$ %"%#$%iid%щ#px%Ҫ"#buf%0#sid%0# ptr%Չ#bol%։#$%(%̞#%$%,$$[" $ $ $ 5$l%x ,  #t0 #t1 #9 "# "# # D #$  #(%  G#len 0#pos 0# sid 0#srv P#oe "#src #buf #& be "4 -& ! 0#. #`& srv `&# # #P&X act $#bck $#,& act #bck #'  #Q # # #  # #8 # P#map -&#  f&#,V ‹&#T ë'#7 ī'#9 ū'#/ ƫ'# ǫ'# ' P'*(  #3 #T9 #G; # I@ #* #\ #! #-*(! 6(R( b( (%*dow*#h1*#m1*#h2* #m2*#)*min*i#max*i#%*ˉ#h%*̉#,)*`?*Ϡ#U*Р#_)*i*ȉf*(%*)%*b()*ptr*str*reg*׉)])%,**#val*,)#ptr*_)#%*0# len*ډ#$?*ۉ#('* *p*i*ll*id*'*a*.*I>**L%0*i*#ptr*#len*#?*# ctx*)#*y%*kw*# *+# %*+# B*+# *0# &* #+ $ + 9)*E+ "  E+ +K++ZB* *!#kw*",#arg*%,# 1&*&# p%*'#>*++ + +++9&* *#kw*+#,*!",*%#str*$*$,; )U%px"&op&totS'l&curPQ'8PW(,&maxƉh)*v̉+,J<M0U%pxL"Q&srvNPR,,bv----.-7;/ :/\7:+@-M7iU%pxh"R+-<8{ U%srvzPS&p|"V0#:c,,9=----+-s9U%srvPS&p"V0#:LJ,,LJ----$h.7rU%p"W&srvPS';V&actp&bckl1Cf2w`1Tf3t4k/:5U5srv4PS2p6"W2grp7k/P6#:bc6q8_S7.,----7.,ˉ----(/8x OPR7+/,/----7W/q/-/,/9/P,/-/$:/;F;sEP07FU5p"V2srvPS?u;70,----,M009[0W-g04~19PU5sPQ3p"2grpk/R7F1~1-1)@1P7]11-1,1ԍ-1)@1P:1*8;sP3grpk/:17u;stP:1;{;szP3grp|k/42W8oU5srvnPS2pp"V2grpqk/W6#:6q87T2,----7p2,0C----)(8x PP43: U5srvPW? 8?72p"p2grpk/l72,LW----73,Wu----7B3q/+:-/,/+:9/PAj3888Q?773q/I`-/,/I`9/P73q/`o-/,/`o9/V,M0ox9[0S-g04@48hU5sgPV7,4@4Б-N4,/Б9/S,Y4 -g4:Y49U;sTP:r4:^;s]P4g59v U5srvuPS2pw"V6#:c6q8S74,;?----74,?S----( 5@8x PR7'5,ϒ----7S5@4-N4,/9/P,g5-u5:5:O;sNP4-67+U5srvPS2p"V6#:36q8 75,/3----76,K`----(6X8x PP,Y4ٓ -g446:0U5srvPS? 8?72p"p76,\g----76,g----76Y4/2-g4,@4֕-N4,/֕-/>[7O;U5p"V2srvPS?u;7G7,Ŗ----,Y4ϖҖ-g4B78qP fU5pxp"5uripVC7p8[rPp2psS89tl84:uhB8W:Pp U5s P8[PT2txn8P2req V2msg8S2px"L84:0H8,PW2lenPD89@2ctx1X2pS)p8001x3c)2hex0R185PB9r7P&U5s S8[PW3txn82msg8T2px"V84:0P2lenPS2ctx 1X2p!Q1&8P:?LB6>;s0fU5sr 8 ;uPp2errvV6(Doutœ71:6>ۜ-G>9P>P(I:2lenW7:p>n9>W9>D)@>S@>@@>V@>7:>!->9>W9>V)@>X@>R@?T7;?"-%?9/?V-:?( ;@E?Q@N?P1EX?7;e?"-w?9?W(X;0@?P@?\@?V7;?=N-?,?=N-?,@=N9@P-@)X@?S,+@l-<@,H@l-Z@1l@f@P,@9@P-@7=q@٢-@9@l(R<p@@W@@h@@d@@V@@`F@̢7<@<-@)@@Q@AR,?-?,?-?,@9@P-@7<!AMY-/A)@;APAM=pEA79=?p9?P,?s-?,@s9@P-@,1-17i=HA-VA-bA,q/-/,/9/P7=p>>9>W9>P)@>S@>L@>V@>H7>?-@-?,?-@-?,@-@9@P-@,M0+9[0S-g0.Z>09FGsFZ>GpFe>`> k> V.>75PGpx4"/;4PHn;6H76*srv7PH:7P.?8PGpx"Guri/7H[P*cH8.e?*;zPGpxx"/`?yGleny*h{0*l{0I*__v0J?j:?P;p>"=;>P3srv@P?:@P?A/I3sTP.?7// 6"J?6?= 5"IJ+@?=G+C=F0.H@C//B/Jq@T?=S?3tUCJ@;P;p"=;P3srvP?mP?:P3grpk/?e;K)7-J!A8P;grpk/?/3sPI?8/:HA;;grpk/?:":mA;;grpk/;sPB&B$<pU5s SAA3__v*>AA3__v*>13__v*>13__v'>AB3__v'>13__v'>BiBB9_{U5s^ V2p`$P2erraSBDc79U5s 3fd2errP(mC8^$ DT2retP8?L1Ǫ8#'H2src(X7(CD֩9DQ9DS7SCD3}9DQ1B}@D@12__v=>P7CD %-D(C8^$\DW2ret]S8?]S(CH2msg7CD9EQ9EP7DEˬӬ90EP-;E70DD9DQ9DS7PDD9DQ9DS7pDDƯ9DQ9DS,Dذ9DQ9DS߳-G>-P>7ED9ER9EP7FE90EP-;E,iFQm-vF%?>%)?>8>P( I2arg?S7HIŵ-I,Iŵ-I-I-I77HI͵-I,I͵-I-I-IAH ?&E%?E%1 ?E8EPAH$1?&M%?M%7HIIX-I,IIX-I-I-I,I`s-I,I`s-I-I-IA2I?&^%?^%AXI1>?&j%?j%)2begzV3endz1 ?&%?%LI@ i= hLI -= +=x += ,MJ:<иdU5px"S5l4  5l75dirCtCE+VCP%+W1?&%?%M%K97p1U5px"S5l4  5l75dirCtCE+WCP%+V8:PR1?&%?%MK8@ºU5px"S5l4  5l75dirCtCE+VCP%+W1q?&%?%MIL9:кRU5px"S5l4  5l75dirCtCE+VCP%+W1?&%?%ML; `ٻU5px "S5l4  5l7 5dir CtC E+VCP% +W1?& %? %MmM: YU5px "S5l4  5l7 5dir CtC E+VCP% +W1&?& %? %MM8. `ټU5px, "S5l4,  5l7, 5dir, CtC- E+VCP%- +W1?&3 %?3 %MNZ9F U5pxD "S5l4D  5l7D 5dirD CtCE E+VCP%E +W8D<G P1&?&M %?M %N9r UO[+NpOJ +NOL+NO-LNN ~O-MNO qpO.vOOwBOPO.Q1OO/;0Qnow/Em?ERAE3CD^7roS UH 0oBTGQqFez "D"E#"F#9 %-p5 %- ?&~# !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&R#0 0&X#4 .&~#8 Z&~#< &#@ &">#D &#p#F H&$^#G b&(n#H &1#L &7#T d&8#X &:~#\ "&<t#`   &R &&R# &X#B &~#p n   3 $[ >   # #    R #J #t #  w2>40YG %ao b;#ڏ#0#n F#" # 7    b #  9    #  #  # bit ~#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H0wq1D#rq2D# 3~#04~#450#86R#< 7#@8~#DLLL<]4!w !x#!ym#!z0#  !{0#'!|0#r!}0#n9!~0#?!0# -!0#$4!#(  )8J K0#* L0#{M#fdN~# ?O0#expP0#y5Q#6R#e5S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P3 #T9 #X_ 0tstru#lenv~#p p 0 v ' p zm#Lm# L#! #feQ#beQ#~# ?~#$Z 0#(D#,req0 #0rep0 #4siq$#8 #$#a#srv/#p/#Q /#> $#txns# ~#"#$#2ª$## w#w#,G$#0#_ - J ]s Tn  #!s # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#`? P#  Q # R~#$ S~#  T0# U # Vm#* W #A XR#' Y #` Z# [0# b #) c# T Q4 m # n~#S o~# p~# q# r#  s~#$?5 t #(V6 u #, v#0 w#4{ x#8@ y#<h zm#@e {~#H |m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#H#I~#  J#$    Jn9~#get~#put~#u~# ##U5$8len$90#cr$:0#$;0#b $Cv$D#n9$Ew#$Fw##*$Gw#3$Hw# #    D #¬S#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#SmD#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#m#sl##  #W#8 #~#@#3##b#U# #6 #req##rsp##\uri## ####I#~#?#0#d) D##~#P# m#:X a^#_%#k`%#aue+,#-#.~#/#  2P #D#>>d2IW(tD # F#OF# ~# h~#r~#~#a#B4 #,aclm#0m#8m#@m#H>m#P>R #Xsrv/#de ~#h? ~#lh  #pK#Z #~##~#0#~#g~#[# ~#R ~##~#~# #G #R~#7~#-z"##/~#m#'!#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#F#zF#F#F## ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p a# ?a# ~# o# Q# m  # u  # Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p # # ~# Z~# "# ]"#  o# !o# O"o# q#"# #"# $~# w %# &~# '"# = (~# )~# *0# +0# F,# :,#HyF &0#f 0#0# p7 `?4un5J in6a#p2u7# 2!i;  m#!p #srv"/# /I@"J/# K~#* L~#M~# N~# O#B P#(RQ#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H`?[a#Lp\a#\?^a#l`~#|oa# b#@d/#d/#e#o fa#wgw#h~#i~#;i~#$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v5#hw/#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#ix ,#t0#t1#95#5#~# D~#$ ~#(4 <#len0#pos0# sid0#srv/#oeQ#src#buf9 #R beQ 4w !0#.m# srv # ~# ~#/ Xact;#bck;#, act#bck#!~#Q ~# ~#~# ~#~#8 ~# /#mapw #  #,V #T !#7!#9!#/!#!#!/!t" ~#3~#T9~#G;~# I@~#*~#\~#!~#-t"! " " "6 ]#D ~#<# <# /<###  #$f&P#(} P#,P#0i#4Qi#<#pxQ#sv/#w#Dw# ?0# iid~# J~#sid~## "Θ#G$iid~#pxQ#buf0#sid0# ptr~#bol~#q$ (]# # # $ 2$p $$p $"$<,~ݽU#si+Q$$%%P%%R&%k~'j~(nowj~)@%<6 U#si5R)%q<DU#siCQ#msgC%S*%%Q%%R$%Q%%R% 6 +%1(buf~0 )&<URU#siTS#msgT%Q* &&Ⱦ%&P*#&%Ⱦ,%*:&&,&*t&&%%&Q%&P$&#%&P,&$ '%','+&+(buf0 +&D((buf0 &&O$W~(nowV~''V~& 'n#L~(nowK~''K~+#'&(buf0 -[%0'e-J %0'-.vP',-w~ t'. -'Qc'-(;0- )Q0-)R0- )U0- )Vo-)W'D5E"`0<y 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz !D!E#!F#9 +-{5 +- ?,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,h#0 0,n#4 .,#8 Z,#< ,#@ ,">#D ,#p#F H,$t#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7  ,h ,,h# ,n#B ,#1{  *  3 % #3#4#c#5##6# #7# O #8##9#!#:#N", !"-#" ".#!"/#"0N#  $[ >   _# #   R _#J #t #  wtm,w:x#+y#}z#{# I|#]}#A~#u## #$#(2>40YG o b#_#ۦ#n ܼ#" # ,7 O bO# __ ,  4# _# _# bit#u32"0*+e#key,# n #p #7" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D7g]4w x$#y#z0#  {0#'|0#r}0#n9~0#?0# -0#$4g#( w E )8%J %K0#* %L0#{%M#fd%N# ?%O0#exp%P0#y5%QW #6%RW #e5%SW # 6%TW #$ib%U #(ob%U #,x %V0#0%W#4Q Q wE  # %U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D< Q #L Q #P #T #X]  0 tstr u#len v#     p  z$#L$# $#!$x#fe$_ #be$_ #$# ?$#$Z $0#(D$#,req$ #0rep$ #4si$g"#8 $#$$#$#srv$#p$#Q $#> $w"#txn$[# $#$ #$"#2$ "## $w#$w#,$="#$0#   & #<&!# &"#&# #  ]( Tn  _#!( # 8 kk auid^1#gid_#`&#~ buxa8 !LfdM# N#hO#`?P#  Qr#R#$S# T0#Ux#V#*W#AX#'Y#`Z# [0#bk #)c#r TQ4m#n#So#p# q_# rT# s#$?5t#(V6u#,v#0w#4{x#8@y#<hz#@e{#H|#L~ ~  rCfA#bB #\.(?cbC\#{D# E7#evF7# Gl#HT#I#  J#$ l j Jn9#get#put#u# 0#r) D###P# #:b a^#_%#k`%#a/e+,#-#.#/# m bP ##C5)8len)90#cr):0#);0#b )Cv)D#n9)Ew#)Fw##*)Gw#3)Hw# (    D (šA(l(މ#m_l(߉#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(A[D(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(N#sl(#  (W#8 (#@(3(#b(C# ( #req(#rsp(#\uri(# (#(#I(#?(0#0yF &0#f 0#0# ? I@IJ# K#* L#M# N# O#B P#(R_ #S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H`?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# ve #hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#?_ (tDRx# #O# # h#r###B##,acl#0#8#@#H>#P>$#Xsrv#de #h? #lh ȭ$#pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉##G #Rډ#7ۉ#-&##/މ##'%#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# _ # m "# u "# Jp# p# # # #  # # g# # B# p # # # Z# &# ]&#  )# !)# O")# q#&# #&# $# w %# &# '&# = (# )# *0# +0# F,i## :,i##H 4 ; '' #'! #srv'"# S!D$ $#$G# $G# /$G#$#$#  $#$f&$P#(} $P#,$P#0$i#4Q$i#<!$px$_ #sv$#$w#D$w# ?$0# iid$ˉ# J$ˉ#sid$ˉ#! $"$#="$iid$щ#px$_ #buf$0#sid$0# ptr$Չ#bol$։#g"$!($S!!$!!$! w"w k " }"" Q "I"p7!`?4jun5 in6"p2u7"#i#x ,4#t04#t14#9e #e ## D#$ #(#G#len0#pos0# sid0#srv#oe_ #src#buf #$be_ !4*$ !0#.#]$ srv]$# # #$Xact"#bck"#,$act4#bck4#%#Q # ## ##8 # #map*$# c$#,Vˆ$#T è%#7Ĩ%#9Ũ%#/ƨ%#Ǩ%#%%'& #3#T9#G;# I@#*#\#!#&-(7(#&)#*#+# ++#6,#?-#-.'#/(# 0&#$'&"! & & & (' 1$1%#kw1&# 1-Q'#Q'N_ _ (''1516#kw17'# '& '  '###'( (##G#'I(-SC-O#-P#h-Q# -R# ) -;uid-<#gid-=#->#$-?# ,-@# -A#!-B#a-C#-D# |-E#$ -F#(<-G#,-H#0-I#4+-I#8J-J#<-J#@-K#D-K#H-L#L -L#Pm -M"#Tu -M"#-S(# -T~ #Y-U##,=<`U$?:N~$<: $<:_ $';_ %err;$ ;&V*'&>%'>%&+(su? ~) @S**Cp'&^%'^%+Cp'^)^P**x'&b%'b%*+'&f%'f%*,+'&q%'q%&C+H)r,P*+0'&Z%'Z%+0'Z)ZP,+,8Q-,.,8Q-----'-/x)C"g4-P*+'&%'%*,'&%'%&^,'$.,-,.,-----'-,,, -,., -----'-,,, 9-----'-/)'0~(resP 0,n1m04- -1+1x+N1,2r-< :U%msgr-$n9  3.=o@U4sn 4pxn_  4urin&R5repp d5svq`5svsq\5msgr h&.6 #*.E6}(S7len~+8&%8%+86P&. 6"C./P 6 $0P&.h 6"./ 6 $0P . 3/&=K\U4sJ V4repJ  4uriJ&W7pxL_ 5msgM h5upN0S,t//MZ-/,//-/./0R-/9/_,:buf ;/<U:nTP2c0q=`U%s V%rep W%uri&1P*_17__v>*y1"27__v>/ 8\;1=[:tZ=2= U4s 4rep  ?25msg @&2 5es3~,52/58-/&2!8=6=~. 3-3-*3-63-B3>N3~/8!AZ3~Af3Q&2x!5pnq35tm.3>3~>3P./-/ 3 i#Bq3=NCoutLr-1n9LCerrM31p.MCptrM7endO7cP7 3 -D3"Cnow!3Ctm!3 <E@="UF7*K33 >F*L33 ~F*M3F[+4pFJ +4F.v/4FwF -\ `4G FQO4 x4GF҅4 m4?(I_ F.;0Hnow.GF -XI(Hpid-ZFX-[F-^ F/F/F, 0F Q0FR0F^S0FlT0F U0F V)FWu56'W'`7H600?y !07i  "02-y &ik 27 5int 60 >Em ?ER AE3 C D^7ro S UH  0o BT G QqF1> >#D ,#p#F H,$#G b,(#H ,1#L ,7$#T d,8$#X ,:#\ ",<#`5 7@ :$W c $ , ,,# ,#B ,#jc3$[> ##" YR#J#tY#iwy6 7# w8#Tn  #!#k 2> 40YG o b#Z##n #" Z#j7 b#j  r# # # bit#u32"0!*+#key,#FnF#pF#!u" - !#ref!F# H0wq1#rq2# 3#04#450#86#< 7$#@8#D u]4"w "xK#"y!#"z0#  "{0#'"|0#r"}0#n9"~0#?"0# -"0#$4"#( )8$J $K0#* $L0#{$M$#fd$N# ?$O0#exp$P0#y5$Q#6$R#e5$S# 6$T#$ib$U #(ob$U #,x $V0#0$W$#4   # $U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8) #< 7#@7#AW#D<#L #P #T #X 0tstru#lenv# $  $ *  p z!#L!# #!>#fe0#be0## ?#$Z 0#(D#,req #0rep #4si8!#8 "#$"##srv#p#Q #> H!#txn,# #s#Z!#2q!## Â#Ă#,!#0#   ]1 auid ^<#gid _&# `1#D bux a K ! Lfd M# N#h O#`? P"#  Q8# R#$ S#  T0# U># V!#* WT#A X#' YZ#` Z$# [0# b1 #) c#8 T Q4 m`# n#S o# p# q# r#  s#$?5 tT#(V6 uT#, v#0 w#4{ x#8@ y#<h z!#@e {#H |!#LK D T Dp 8pCfAT#bB #".(?cbC"#{D$# E7#evF7# G2#H#I#  J#$2 Jn9#get#put#u# #8 ) D###P# !#: - a ^$# _%#k `%# a}e+,}#-#.#/:# 8 -P F##  5'8len'90#cr':0#';0#_b 'Cv'D_#n9'E#'F##*'G#3'H# &    D &e &l&ޔ#m_l&ߔ#u&#u_l&# v&#v_l&#c&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st& &D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&&#sl&c#  &W#8 &#@&3&#b&# & #req&#rsp&#\uri&# &#&#I&#?&0#yF &0#f 0#0# I@IJ# K#* L#M# N# O#B P#(R0#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X!#@!Y#H`?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wg#h#i#;i#$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v6#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#0(tDR># #O# # h#r###B''#,acl!#0!#8!#@!#H>!#P>E'#Xsrv#de #h? #lh '#pK#Z #̔##Δ#0#Д#gє#[# Ӕ#R Ԕ##֔#ה#؎#G #Rڔ#7۔#-m)##/ޔ#!#'(#id#+#!#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# G# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# 0# m &# u &# Jp# p# # # #  # # g# # B# p }# }# # Z# y)# ]y)#  # !# O"# q#)# #)# $# w %# &# ')# = (# )# *0# +0# F,&# :,&#Hrs; %% !#%!$ #srv%"# $ D #h# h# /h###  #$f&P#(} P#,P#0i#4Qi#< px0#sv#ɂ#Dɂ# ?0# iid˔# J˔#sid˔# "L#!iidє#px0#buf0#sid0# ptrՔ#bol֔#8!!($ !ϛ !ײ H!< Z! $ N! q! $ `!!%)dow)#h1)#m1)#h2) #m2)#")min)i#max)i#%)˔#h%)̔#A")`?)#U)#t")i)Ȕ!f)!!%)"!%)w!")ptr)$str)reg)מ"-#%,))!#val)A"#ptr)t"#%)Q# len)ڔ#$?)۔#(<# )p)$i)ll)id)<#a)C#IS#$#L%0)i)#ptr)#len)#?)# ctx)## $y%)kw):# )+$# %)$# B)$# )0# &) #%$ E %$ Z" $Z$ 0 $ $ Z$ $`$$ZB) )!!#kw)"/%#arg)%%# 1&)&# p%)'!#S#1$$ $ %$$ %9&) )!#kw) %#%# "/%)%#str)$#$%acl)* )+!# 4),# tC)-!# ).# )/0#5%%C)> )?!# g)@!#pol)A# )B0# p.)C#&p7!`?4un5in6.&p2u7%#&x ,r#t0r#t1r#96#6## D#$ #(''h#len0#pos0# sid0#srv#oe0#src"#buf #E'be0!4j' !0#.!#' srv'# # #'Xact.&#bck.&#,'actr#bckr#(#Q # ## ##8 # #mapj'# '#,V'#T (#7(#9(#/(#(# ( (g) #3#T9#G;# I@#*#\#!#-g)! s)) ) %) 1$1%#kw1&:# 1-*#* & 0 0 )2*1516!#kw172*#A*) */SC/O#/P#h/Q# /R# , /;uid/<#gid/=#/>#$/?# ,/@# /A#!/B#a/C#/D# |/E#$ /F#(</G#,/H#0/I#4+/I#8J/J#</J#@/K#D/K#H/L#L /L#Pm /M&#Tu /M&#/SA*# /TD #Y/U#7,3?($(%!#D(&)#('# `,? =-? >#Y> ?R#%,? F! G]!`? H7,!? I],> Bop D]#v J`,#&._>n0U'fdmV(?mS(>m.(^$m.)[?oX)e?pW*retqP)u?t+-Vr,__s~$-~!~0!~>!~7,__u~.,__c~w- )?,H)?,.!*__s$R-!0!>!7,__u.,__cwU--&.>U(!>V( ( /P?/>*fdS*errd*msg:`0.1.2."T3fdS4/>(DU5 '8R6!)>S7err*V8@/ >:PU5!9>Q8g/?HU5!G>Q9l0>glU:sf$ V:reqf W6Jhl0S6=ip;/r06M<0R<0Q=/!7retR; 0010;"00<0P;900351000KS101000KS<1P11,>0k?j3nowj20+3buf 20)3buf >0O$W3nowV?'V>1n#L3nowK?'K43>pU5?&5< 5<05'0:err5 7ptr:l7val0p6?Q+1@&%@%+ 2@&%@%=33!6h6p?d7polQ6D)S@Jl0+~2@&%@%+2@&%@%=2"@&%@%."@/6P+ 3>P@&%@%-7acl%P64:Q;L33Rf<4P;e33<4P;~33j~<4P;33<4P;33<4P;33#14;33Zl140314>4)3:?(2044;>2U:px00:l40$ P:l70$:dir05tC1Z$5P%1$R45=F U:pxD0:l4D$ P:l7D$:dirD5tCEZ$5P%E$6Gp6?GV6>GR6H/S/F?/>7.0"6fQ64:fl6S>fh6q>fd6M>f`Aw>6UB*L55 B*M5B[+5BJ +5B.v5Bw6CB-Q 6D(I0B.;0Enow.;K )>MK @6' *6%$B5Lp@0@y $07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez 'D'E#'F#  n # p #e" - e# ref !#R]4&w &xR#&ye#&z0#  &{0#'&|0#r&}0#n9&~0#?&0# -&0#$4&X#( h ! %%#4%#Z%># len% ># \%!>#E%"#h2L40YG o b#$[L[ '#[# k R'#J#t#  w'##n #" # E 0Tn! ! '#!!0# @ k hp 7 `? 42un 5in 6p 2 u 7@# b#   ### bit>#u32 "08 * +# key ,# H 0 wq 1# rq 2# 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#`#  buxa!L fdM># N>#hO>#`?Pk#  Q #R>#$S># T0#U#Ve#*W%#AX#'Y+#`Z# [0#b#)c#  TQ4m1#n>#So>#p># q'# r# s>#$?5t%#(V6u%#,vQ#0wQ#4{xQ#8@yQ#<hze#@e{>#H|e#L%>>> A Q> A,SC,O>#,P>#h,Q># ,R>#  ,; uid,<># gid,=>#,>>#$,?># ,,@># ,A>#!,B>#a,C>#,D># |,E>#$ ,F>#(<,G#,,H#0,I#4+,I#8J,J>#<,J>#@,K>#D,K>#H,L>#L ,L>#Pm ,Mh#Tu ,Mh#,SW# ,T#Y,U># )8(J (K0#* (L0#{(M# fd(N># ?(O0# exp(P0#y5(Q #6(R #e5(S # 6(T #$ ib(UE #( ob(UE #,x (V0#0(W#4    E # (U? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) <#< E#@ E#A e#D< #L #P #T #X t 0 t str u# len v>#  E  <p  z e#L e# #! # fe # be # ># ? >#$Z 0#(D #, req E #0 rep E #4 si &#8 k#$ k# # srv !#p !#Q !#> '# txn # ># .%# '#2 ,'## Å# ą#, &# 0#t  ) >#<)!># )">#)## B ]5+8len+90#cr+:0#+;0#.b +C v+D.#n9+E#+F##*+G#3+H# y*    D *4* l*># m_l*># u*># u_l*># v*># v_l*>#2* l*># v_l*># c*># c_l*># r*># r_l*># O*rq*st*D*P *0# sol*# eol*# som*0# col*0# sov*0# eoh*0# cap*# sl*2#  *e#8 *>#@*3*y#b*# *K # req*O# rsp*O#\ uri*# *#*#I*>#?*0#) D##>#^# e#:+D##^ #a#^##_%#k#`%##a+e"+",#"-#".>#"/# i^P ##9 -- 5 --?.>#!. #. #b . #  .#.#A.# .#z.# .#$.#(+ .#,M.#00.#4..>#8Z.>#<.#@."L#D .#~#FH.$#Gb.(#H.1#L.7#Td.8#X.:>#\".<#`. ..# .#B .>#     3/C fA%# bBE #.(? cbC#{D# EE# evFE# G#H#I>#  J#$  2 Jn9># get># put>#u># #I&z(tD# #O# ># h>#r>#>##B"#, acle#0e#8e#@e#H>e#P>"#X srv!#de >#h? >#lh Ȉ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#ؿ#G #R>#7>#-%##/>#e#'$# id#+#e#t>#4 >#>#0#i0#0#0# z#0#+z# 0#w#w# w#$0#0#`0##z#### >#8#>#0#j0# 1#w#w#w#w# w#w#) w# w#Q w# >#cap >#p #?#>#o# #m h#u h#J~#~#>#>#># ># >#g>#>#B>#p ##>#Z>##]# # !#O"#q#%# #%#$>#w %#&>#'%#= (>#)># *0# +0#F,D"#:,D"#HyF &0#f 0#0#  ;  e#! # srv"!# !I@"J!# K>#* L>#M># N># O#B P#(R #S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H`?[#Lp\#\?^#l`>#|oa# b#@d!#d!#e#o f#wg#h>#i>#;i>#$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v!#hw!#yw#yw#jz0# {1#}w#}w#~w#~w#w#.z# 0#w# w#w#Qw#U>#D"x ,# t0# t1#9!#!#># D>#$ >#("<# len0# pos0# sid0# srv!# oe # srck# buf# "be  4# !0#.e#8#  srv8## ># >#!c#X act!# bck!#,# act# bck#w$>#Q ># >#># >#>#8 ># !# map## >##,Vc##T Ã$#7ă$#9Ń$#/ƃ$#ǃ$#$!w$% >#3>#T9>#G;># I@>#*>#\>#!>#!-% % .%K %D  ># <# <# / <# 7# 7#  7#$f& ^#(} ^#, ^#0 w#4Q w#<V& px # sv Ƚ!# Ʌ#D Ʌ# ? 0# iid ># J ># sid >#m& " ΐ#& iid ># px # buf 0# sid 0# ptr ># bol ># & ( %  V& m& ' '  ','  '"g'=@@U# V#!!S$5(0@/WU%s. V&txn05(p&fe1 l'"2;(R'*2;(S('A()R(*[(P+'&h^S, (H"-\l,(`"-\r.F&hXS/e(09F>0sFe(0pFp(k(v(&1P@>`U$(?U%s V'@eQR28)@>U%s V%si S&reqE P&repE Q38))J))V)4x"5b)P6o)J^7tv1Io)7tv2Io)8retK^u)<2)l@>U%s V%si W())EJ**P)*()A()R()[(3A(W)R()[(/'*n#L>0nowK>9'K>"*]@AU:s@ V:si@ W;reqBE p;repCE S(**2M)*)*3*)*)*<*B-0bufE 9n9>"`,?j  U:si V:sii S((+8)o)J))V)4"5b)P(Q+8)*B)J))V)4"5b)P,+"=8u>P3`,2)m,3w,*,Q),(+8))J))V)4"5b)P(+`,I)m,3w,P\*,R),( ,A()R()[((5,8)  )J))V)4#5b)P(L,,j  ),3,  ),1u)6P U:t5;s7 V=*8>p=H*90l=*90h?) ?) ?4($ ,-0#@?031  )1,-p#=?0R31  )1(-1S ^ )1((.1A)2)2( .1 *2R*2W31 '*2R*2W(F.1Na)2*2S(b.1p)2)2(~.1)2)2(.1/;)1(.#2Ry)02*;2W4#5F2R(.#2)02*;2W4#5F2R(./R2)`2)j238)@X*J)W)V)4#5b)P(E/v2)2(\/v2)2(s/2)2+/.R@?0(/2)2(/v2)2(/A(*R(S*[(P(/2)2(02*2P*2Q(202*2P*2Q(R02*2P*2Q(02w)2(02'*2P*2W(02,C*2P*2W32Oj*2P*2W,0$;len.>P( 18)()J))V).(5b)P(412sv)233sv)3(^13).3383)E3(1W3)h33r3)3383*E3P(13)3.;8len><1&0bufE <1(*u0buftE /#2>#u>0t1t>0t2t>9j>0nowj>/3"0t/3 ~0t}/83 v0tuP;err>S;fin>RBZ %%B ,XB y>B,^BB[-N4BJ -N4B.vn4/Bw> 4C B/Q4B;0Dnow<<B $B0#Ej ( ) E, )e) B1>B Q0BR0B U0B VBWQ3=1P~ p0@yd58len9d#cr:d#;d#7b CvD#n9E#F##*G#3H# % 3@3p U len3 cr3 :W @3 e%V new3Q intk&Q|!0*Ay7i "%2-y&^kint6%>:m?:RA:3CDS7roS UH % 9z DE#F#P7 [JG[# k9 #AJDoBTGQ[ 3   # #   R #J z#t # " w( 234%Y-G 8to bN#ڗ#C#n Y#" # , 9 -g5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .s#8 Zs#< #@ "3#D #e#F H$#G b(#H 1#L 7#T d8#X :s#\ "<#` # #B s#t  m  3 b#  `  # # # bits#u32"%*+#key,`#n#p#: H0wq1k#rq2k# 3s#04s#45%#86P#< 7#@8s#DJJJ:]4w xg#y#z%#  {%#'|%#r}%#n9~%#?%# -%#$4#(  )8J K%#* L%#{M#fdNs# ?O%#expP%#y5Q#6R#e5S# 6T#$ibU. #(obU. #,x V%#0W#4. # U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) Q #< ,#@ ,#A L#D< #L #P ] #T c #XE E . K p 4 W t ] Tn  #! # k auid^#gid_v#`# buxa  !LfdMs# Ns#hOs#`?P#  Q #Rs#$Ss# T%#U #V#*W #AXP#'Y #`Z# [%#b #)c# TQ4m #ns#Sos#ps# q# r# ss#$?5t #(V6u #,v/ #0w/ #4{x/ #8@y/ #<hz#@e{s#H|#L   ss s  / s  V CfA #bB. # .(?cbC #{D# E,#evF,# G #H#Is#  J #$ 5    N<_``#@a #setb #clrc # Ad #@e #remf #clog #T5h# 9i1#$BjC#(P%k1#,Hl1#04m"#4ns#8 s s s    s 1s!C7qp7`?4un5t in6tp2u7I# SCOs#Ps#hQs# Rs# I ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm Mq#Tu Mq#S# T #YUs#@'s4Ufd& Rdir&sQ/ (P!A,s@`Ufd+ Pdir+sR:A2s`Ufd1 Pdir1sRTA8sUfd7 Rdir7sP!ret9sP :P@AsUfd@ Pdir@sR!retBsP"$ CP#@JUfdIsP#@S UpRexpRsR ITsS!fdUsW!iUsQ Vh AWsd AXsV @XsS!fdsYs` Z_$ P$ P%&&'&&(ks)js*nowjs(+F's*nows*expsKAs UpV+TAJ +@[ +_Al +A}  @sS#A  UpS@s  Up#iA |!U!pR,[,J ,mrs 2 ,t",.vLV ,ws p- , Q_,;%, X,s, Q%,R%, U%, VV,Wk  k CA vA&1S}#!0AyintCAC#SZS72A,A0a !Ղ7i "-y&k6>m?RA3CD roS UH   S _ %qF p oBTGQz #D#E##F*#24YG o b#$@[E #E#US R#J#t#Sw##n #" #S9 -5 -?%#! # #b  #  ##A# #z# #$#(+ #,M#00#4.%#8Z%#<#@"#D ##FH$#Gb(#H15#L7K#Td8K#X:%#\"<#` K # #B %#  S S3( b(#88S   #8#8# bit%#u32"*+>#key,# n #p # " - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @]4"w "x#"y#"z#  "{#'"|#r"}#n9"~#?"# -"#$4"@#(PS )8 J K#* L#{ MK#fd N%# ? O#exp P#y5 Q0#6 R0#e5 S0# 6 T0#$ib U #(ob U #,x V#0 WK#4 * * P  #  U? }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0 #4H %#8) v #< #@ #A #D< *#L *#P #T #X 6 0 tstr u#len v%#    v p  z #L # #! #fe i#be i# %# ? %#$Z #(D #,req  #0rep  #4si q!#8 U#$ U# #srv #p #Q #> !#txn e# %# # !#2 ª!## # #, G!# ق#   |  S] Tn  #! # Sk auid^#gid_u#`# buxa  !LfdM%# N%#hO%#`?PU#  Q #R%#$S%# T#U#V#*W(#AX#'Y.#`ZK# [#b #)c#  TQ4m4#n%#So%#p%# q# r# s%#$?5t(#(V6u(#,vT#0wT#4{xT#8@yT#<hz#@e{%#H|#L   (% %  %DST%  D{CfA(#bB #.(?cbC#{DK# E#evF# G#H#I%#  J_#$ZS _ Jn9%#get%#put%#u%# :#  A %#AM#p7`?4un5 in6p2u7#") D##%#Z# #: f a ^K# _w#k `w# a3e+,#-#.%#/j# q  fP ##   " G5&8len&9#cr&:#&;#b &Cv&D#n9&E#&F##*&G#3&H# %           D %žE%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%E_D%P %Ղ#sol%#eol%#som%؂# col%ق#sov%ق#eoh%ڂ#cap%_#sl%#  %#8 %%#@ %3%#b%G# % #req%#rsp%#\uri%# %#%#I%%#?%#:yF &#f ##I!SI@IJ# K%#* L%#M%# N%# O#B P#(Ri#S%# T%#$5 T%#($U#,6U#0tV%#44 V%#8'W%#<X#@!Y#H`?[#Lp\#\?^#l`%#|oa# b_#@d#d#e#o f#wg#h%#i%#;i%#$j%# j%#Rj%#k%#l%#Fm%#ido#p#b p#q#r#us#?t#Vt#gu# vo#hw#y#y#jz# {_#}#}#~#~##.# ## ##Q#U%# Ii(tDR# #O# %# h%#r%#%##B"#,acl#0#8#@#H>#P>"#Xsrv#de %#h? %#lh v##pK#Z #%##%#ς#%#g%#[# %#R %##%#%##G #R%#7%#-$##/%#߼#'w$#id#+##t%#4 %#%##i### ##+# ### #$##`##z#### %#8#%##j# _##### ##) # #Q # %#cap %#p #?#%#o#i#m #u #J##%#%#%# %# %#g%#%#B%#p ##%#Z%#%#]%# -# !-#O"-#q#%# #%#$%#w %#&%#'%#= (%#)%# *# +#F,2"#:,2"#H   ; $$ #$! #srv$"# ] D  %# # # / # # #  #$f& Z#(} Z#, Z#0 #4Q #<  px i#sv # #D # ? ʂ# iid %# J %#sid %# " #G! iid %#px i#buf ӂ#sid Ԃ# ptr %#bol %#q! ( ]   !PS u ! ! ! * !I2"x , #t0 #t1 #9o#o#%# D%#$ %#("#len#pos# sid#srv#oei#srcU#buf #"bei4" !#.#&# srv&## %# %# Q#Xact!#bck!#,v#act #bck #e$%#Q %# %#%# %#%#8 %# #map"# ,##,VQ##T q$#7q$#9q$#/q$#q$# q$  e$$ %#3%#T9%#G;%# I@%#*%#\%#!%#- $!  $%S (% S"m%3B !!U#W%!!$__s"K%!!$__s#K&%A(!o"U'sig'%S&%#BBp""U'sigA%P(AAMR"&A]"#U)sig^%R*A^%V*+_&P*A`l~ e+[$& +J $&+L$&+.vQ& {+w%u&,S+'Qd&-%@- &eS-A&`- &%S- B&@) -Bl`5 <uUx9#0By 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 09 %-&5 %-?&#!& #& #b & #  &#&#A&# &#z&# &#$&#(+ &#,M&+#00&1#4.&#8Z&#<&#@&">#D &#p#FH&$7#Gb&(G#H&1#L&7#Td&8#X&:#\"&<M#` 7    &+ & &+#  &1# B &#&G]3 n #p #]"  - ]#ref !#qFo BT G Qz D E# F#2>40YG Mo  b'#$[>  X# #  RX# J# t#w( X# # n 2# " (#87 [  b [#kk8   @# k# k# bit #u32 "0 *  +q#key ,#j H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7#@  8#Dzz zj]4w x# y]# z0# {0# '|0# r}0# n9~0# ?0# -0#$ 4#(/ )8J K0# * L0# {M#fdN# ?O0#expP0# y5Q# 6R# e5S# 6T#$ibU^ #(obU^ #, x V0#0 W#4  /^ # U ?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H#8 )U #< 7#@ 7#A W#D < #L  #P a #T g #X 0tstru#lenv#  ^  U p z ]# L]# z# ! #fe#be# # ?#$ Z 0#( D#,req^ #0rep^ #4si'!#8 # $# #srv# p# Q # > 7!#txnR# # b# I!# 2`!# # w# w# , # 0# [ x ] Tn  X# ! # k auid^#gid_# `# buxa  !LfdM# N# hO# `?P# Q # R# $S# T0# U # V]# *W# AX# 'Y # `Z# [0# b # )c# TQ 4m# n# So# p# qX# rM# s#$ ?5t#( V6u#, v3#0 w3#4 {x3#8 @y3#< hz]#@ e{#H |]#L    #3 #ZCfA#bB^ #.(?cbC# {D# E7#evF7# G# HM# I# J>#$9c> J n9#get#put# u# #)  D# # # P# ]#:D a ^# _%# k`%#a+e+ ,+# -1# .# /# 7 eP # w# q qeyF  &0# f 0# 0#p7`?4cun5x in6p2u7#45"8len"90#cr":0#";0#b "Cv"D# n9"Ew# "Fw# #*"Gw# 3"Hw# !           D !‹2!l!މ#m_l!߉#u!#u_l!# v!#v_l!#!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!2LD! P !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!L#sl!# !W#8  !#@! 3!# b!4# !d #req!#rsp!#\uri!# !# !# I!# ?!0#!I@I J# K# * L# M# N# O# B P# (R# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X]#@ !Yz#H `?[#L p\#\ ?^#l `#| oa# b># @d# d# e# o f# wgw# h# i# ;i# $j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v%# hw# yi# yi# jz0# {# }i# }i# ~i# ~i# i# .}# 0# i# i# i# Qi# U#(tDR  # 2# O2# # h# r# # # B_"#,acl]#0 ]#8 ]#@ ]#H >]#P >}"#Xsrv#d e #h ? #l h %##p K# Z # ̉# # Ή# 0# Љ# gщ# [# Ӊ# R ԉ# # ։# ׉# <# G # Rډ# 7ۉ# -ܥ$# # /މ# ]# '&$#id# +# ]# t# 4 # # 0# i0# 0# 0# }# 0# +}# 0# i# i# i# $0# 0# `0# 2# z2# 2# 2# # # 8# #0#j0# #i#i#i#i# i#i#) i# i#Q i# #cap #p #?##o##m #u #Jp#p#### # #g##B#p +#+##Z#$#]$# # !#O"#q#$# #$#$#w %#&#'$#= (#)# *0# +0#F,!#:,!#H@b;    ]#  ! #srv "#  D # # # /# # #  #$ f&P#( } P#, P#0 i#4 Qi#< px#sv# w# Dw# ?0# iidˉ# Jˉ#sidˉ#  "Έ# iidщ#px#buf0#sid0# ptrՉ#bol։#'!( ϊ ס 7!/+ I! =! `! O!!x , @#t0@#t1@# 9%# %# # D#$ #(_" #len0#pos0# sid0#srv#oe#src#bufg #}"be4"  !0# .]#" srv"# # ##Xactf!#bckf!#,%#act@#bck@#$ # Q # # # # # 8 # #map"# "#, V## T  $# 7 $# 9 $# / $#  $# $ $$  # 3# T9# G;# I@# *# \# !#-$! $$ $d 0%C1#?]#g#@]#pol#A##B0#p.#C#$%%#dow##h1##m1##h2# #m2##%#min#i#max#i#%#ˉ#h%#̉#&# `?#2# U#2#3&#i#ȉf#͔%%#%%#6%]&#ptr#str#reg#]&&%,# #]#val#&#ptr#3&# %## len#ډ#$ ?#ۉ#(& #p#i#ll#id#&a#'I'c'L%0#i##ptr##len## ?## ctx#&#'y%#kw## #'#%#}(#B#(# #0#&# #'  ' c&'(   ( w((w(ZB##!]#kw#"(#arg#%(# 1&#&#p%#']#''( w( '((9&##]#kw#(#(c'!"(#%#str#$c'$M)acl#*#+]#4#,#tC#-]#  #.##/0#)ID#3#4]#acl#5)#neg#6# ()C#9#:]#B#;]#%))4'#tC()#)&]*`D<##U'px:'l4:  'l7:'dir:(tC;((P%;w(P&*EG##U'pxE'l4E  'l7E'dirE(tCF((P%Fw(P&3+CT##U'pxR'l4R  'l7R'dirR(tCS((P%Sw(P)y+E`$ $U( _(E_' (1_ )+iBg$$U'pxe'l4e  'l7e'dire(tCf((P%fw(),Cm $'$U(P%lw((El' )_,Et0$$U(P%sw(S(Es'Q*2u),;D$R%U(P%w(V(E'P+BCS,ret-$R%+CS)-FE`%%U(P%w(S(E'Q*2)F-C%%&U(P%w(P(E'V*2)- D0&&U(P%w(S(E' *2ɉ.endW.cS/-0$+5ԉR-&&*5ԉ&.TE&L(U(P%w(W(E'R(r+s+Bl+2h.cW.endd.psV.plS/q.H$05 1`$25 P3.CP(f(U4P%w(P4E'R3.yC(p((U4P%'w(P4E''R33/E.((U4P%-w(4E-' 3x/C6)))U4P%5w(R4E5'Q5s7x/R23/CD0)m)U4 CS4EC'W41C 6lenE7/CPp)y)U8ptrP3]0BW))U4 VP4EV'V41V 2X]&S22YP3M2RDw)$,U4 vV4Ev' 41v 5ixiVW5jy0Q2#*y0p29 y0l5ptrzS9819*P*0&~%0~%-9*P*0~2~P91T*p*0&%0%-T*p*02P/1x$0&%0%1$02P/2$0&%0%1$02P-**0&%0%-**02P394D0,^/U4 V4E' 41 5iih5j0V2#*0d29 0`5ptrW9$3z,,0&%0%-z,,02P9n3,,0&%0%-,,02P/3$0&%0%1$02P/3%0&%0%1 %02P--&-0&%0%--&-02P34{B!`//U4  P4E 'P41  :4{D-//U8kwl,4P(:4D5//U8kwl44P18%0\63P5B>)/0U44=W4b=V5acl?)S-//0&A%0A%35oDK(00U8kwJ0\L2TCMP5kwlN4W75E_0 1U8pat^'S;6qEs(1q1U4tCr(W<6101=,6-101>86P>D6V?Q6Bl@bk6patm'6tmpm'327,D(1-3U4?VAC1AkC2AE22tC(\2B(X2E'S21`2BW5argT/7P%6end03E-225retR37B)033U8acl)2tC(S2cB(V-b3m30\38D)34U4?V4DWAC F4AQB34A8E'42iE)R2ZB(S24V38"ED)45U4CCW4DC ACl5AQBi5A8Eg52iEF)R2ZBG(S24HV2\IV-440&L%0L%349Cr0%586U4Dq0%2Ds49W2Ds49p2Bt:9P2Et:9S)M)3Y:D0%@67U4?4D 8polPAC7AD7AB75arg`5negW2ZEV2iE)\2KC:9S2D49X2D0%T-670&%0%-6702P3i;D79U4D0%P8px 8l4 8l78dirAE8_82D492B:92tC(S5acl)P2E'W2P%'2D2_E2HB-R8_86__s 3;#Ca)99U4D`0%P4-C`0V2Db49S2Bc:9R5acld)PBB99UC7$K;; >C$L< < ~C$M<C[%)<CJ %)<C.vI<ZCwm<DC'Q\<<< 0E?B<t z<+5C/(`<< )FZC)<r <2%v(&,Y <90Fy 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez  D E# F# n# p#e" - e# ref!#R]4w xR#ye#z0#  {0#'|0#r}0#n9~0#?0# -0#$4X#( h n 2L40YsG ~o b#$[L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 -C5 - ?># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 Z>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#` # #B >#J  C  3   b #  6    #  #  # bit >#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8J K0#* L0#{M# fdN># ?O0# expP0#y5Q#6R#e5S# 6T#$ ibU0 #( obU0 #,x V0#0W#40 # U? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) ' #< E#@ E#A e#D< #L #P 3 #T 9 #X_ 0 t str u# len v>#p p 0 v ' p  z e#L e# #! # fe # be # ># ? >#$Z 0#(D #, req 0 #0 rep 0 #4 si #8 #$ # P# srv #p #Q #> !# txn # ># 4# !#2 2!## Å# ą#, # 0#_ - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#`?P #  Q #R>#$S># T0#U #Ve#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$?5t #(V6u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    Jn9># get># put>#u># #>p7`?4un5J in6PWp2 u7#) D##>#^# e#:W a^#_%#k`%#a>e+,>#-D#.>#/h# J xP ##x5#8len#90#cr#:0##;0# b #C v#D #n9#E##F##*#G#3#H# k"           D "&" l"># m_l"># u"># u_l"># v"># v_l">#$" l"># v_l"># c"># c_l"># r"># r_l">#A"rq"vst"D"P "0# sol"# eol"# som"0# col"0# sov"0# eoh"0# cap"# sl"$#  "e#8 ">#@"3"k#b"# "6 # req"A# rsp"A#\ uri"# "#"#I">#?"0#yF &0#f 0#0# s!I@IJ# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H`?[P#Lp\P#\?^P#l`>#|oa# b#@d#d#e#o fP#wg#h>#i>#;i>#$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hw#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B8"#, acle#0e#8e#@e#H>e#P>V"#X srv#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>#O#G #R>#7>#-~$##/>#e#'## id#+#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p P# ?P# ># o# # m ># u ># J~# ~# ># ># >#  ># ># g># ># B># p ># ># ># Z># $# ]$#  # !# O"# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H4; !! e#!!p # srv!"# D  ># <# <# / <# 7# 7#  7#$f& ^#(} ^#, ^#0 w#4Q w#<\  px # sv ȗ# Ʌ#D Ʌ# ? 0# iid ># J ># sid >#s " ΐ#  iid ># px # buf 0# sid 0# ptr ># bol >#  (  \  s ! !p !2!p !!I!x ,# t0# t1#9##># D>#$ >#(8"<# len0# pos0# sid0# srv# oe# src # buf9 #V"be4{" !0#.e#"  srv"# ># >#"X act?!# bck?!#," act# bck##>#Q ># >#># >#>#8 ># # map{"# "#,V"#T ##7##9##/######x$ >#3>#T9>#G;># I@>#*>#\>#!>#-x$! $ $ $6 "'%E9:U#4#n90V#?0$ES$"IR$G+W%O 0&%)F:$;U$E>$"IS'out:(h%$/R$V"% FU0;;U#ETS)retVP*%Ej;;U#EiV$/kP$kS"6&E;!<U#ES(%%\*&E0<<U$"IS$ ^V$^W$E>p+[&+J &+L&+.v&,+w> &, +$Q&$Eehi[-=<0SFy7i 2-y&Skint3CzDH7roSz UzH %z  D E# F# $[ 36   # 6# F 9 -Q5 - ?h# ! #  # b  # # # A# # z# #$ #( + #, M"#0 0(#4 .h#8 Zh#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# ?O%# expP%#y5Q4#6R4#e5S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P #T #X:p  ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    yF &%#f %#%#<tF %<?=Uctr<R!%VoF!%Qage"%PB,=6=T^ibF=%a<%b<%2F:%@==Uctr9<SjF9%Vv9%;%QoF;%Rage<%PBg=q=T^{BFX%==UctrW<SjFW% vW%Y%QoFY%RHZ%ageZ%PB==T^[FJ .vwh  Q  :%!now <b ]N?=0Fy7inti 2-k7r b#k y  # # # bit3# G=>U W Z=>%>R > > > >+7 T>>f >">+7 s;>>> TW>\>f a>c>+7 'si>l> @Tq>t>fQsy>|> vs>>s>> GFF%F%G%GG F DFFDtagO Jy3sF3FF tagO F>N?UsubnewV ~>?W%R&2 .s>>C>>CP Z>>+ qs>>%Q T??fR !?#?+7 s,?/?s;?>?_FsubnewbFF_F_F_ P#*!F3 W^CP?0 Gy7inti 2-k7r b#k y  # # # bit3# u32"% s32#3 ;* +#key,#o1GoP?@U unewo .{Y?@p%VlShT??f&&2??????P_(&$@'@c@o@?  N/Go unewooldoF%F{GG FF F KG! FF FF FG rGG!"ret]N #Fu$F%tag &y&3#F$ %tag &#G 3%x 3"r 3#Go@BU unewo #@sA5pAq@&MVYleSqh}dTAAfh&$A'APAXAaAeAP&AAAA#Go$ u%newo"oldo F% F {G3 G F F F KG! F F F rG!"retN~?G#o BBU "uPx"Vj~!B#B'&SPRT6B9Bf=G{o zuxz|oF}y~HVG(oB2CU 'uPx'V4HBBYd'&mSxPWRTBBfTGo uxoFkeyy3cG1o@CCU 0uPx0W2o(F3VTVCYCf3CCAPM3CCAPM)N$G+$F%`o DD0Gy7i 2-y&Sk2,int3CDH7rH %1>3 %#(  %#,  %#0 %#4 H s#8 ) #< ,#@  ,#A A#D < A#L A#P  #T #XMp  ]ss C f A# b B#.( ? cb C# { D# E,# ev F,# G#  H#  Is# J#$   ?= -?>L# Y>?#?FG`?H?I-> B opD# vJ#G"sDDU?#hfd$sP'__s&S&&%&3&,__u&__c&as[J . v ws  Q!b |ID0Gy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % 0G"fd#s# H$l# G%l#P7 RJ GR# b0 #AJ;oBTGQ[ 3   # #    R # J z# t #  w 234%Y$G /ko  bE# ڎ# :# n P# " # , 9 -^5 -?s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Zs#<#@"3#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`  #  # B s#k  d  3 b#  W ### bits#u32"%* + #key,W#n#p#1 H0wq1b#rq2b# 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1]4w x^# y# z%# {%# '|%# r}%# n9~%# ?%# -%#$ 4#(  )8J K%# * L%# {M#fdNs# ?O%#expP%# y5Q# 6R# e5S# 6T#$ibU% #(obU% #, x V%#0 W#4% # U ?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )H #< ,#@ ,#A L#D <#L #P T #T Z #X< < % B p + N k ] Tn  # ! # k auid^#gid_m# `x# buxa  !LfdMs# Ns# hOs# `?P# Q # Rs# $Ss# T%# U # V# *W # AXG# 'Y # `Z# [%# b # )c# TQ 4m # ns# Sos# ps# q# r# ss#$ ?5t #( V6u #, v& #0 w& #4 {x& #8 @y& #< hz#@ e{s#H |#L   ss s  & s  M CfA #bB% # .(?cbC # {D# E,#evF,# G # H# Is# J #$ ,    N<_ ``# @a #setb #clrc # Ad # @e #remf #clog # T5h# 9i(#$ Bj:#( P%k(#, Hl(#0 4m#4 ns#8 s s s      s  (s : .hp7`?4un5k in6kp2u7@# S COs# Ps# hQs# Rs# @ ;uids# $?s# ,@s#  As# !Bs# aCs# Ds# |Es#$ Fs#( <G#, H#0 I#4 +I#8 JJs#< Js#@ Ks#D Ks#H Ls#L  Ls#P m Mh#T u Mh# S# T # YUs#@*sDDUfd) Rdir)sQDD +P!A/sDDUfd. Pdir.sR:A5sDDUfd4 Pdir4sRKA;sD%EUfd: Rdir:sP!ret:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Zs#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#n9~%#?%# -%#$4~#(  \)8 J K%#* L%#{ M#fd Ns# ? O%#exp P%#y5 Qn#6 Rn#e5 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P #T #Xtp   ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#`?P_#  Qv #Rs#$Ss# T%#U| #V##*W #AX#'Y #`Z# [%#bo #)c#v TQ4m #ns#Sos#ps# q# r# ss#$?5t #(V6u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a N<_``#@a{ #setb{ #clrc{ # Ad{ #@e{ #remf #clog #T5h # 9i #$Bj #(P%k #,Hl #04m#4ns#8v sv s sa  v    s   s     p7`?4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7H8#>#cH*H+%#fd,%#%H"sIIU n9"sS!5"S@UsIIU"fdTv Q"dirTs #fvHgIJU$ofsh!HisQ!HjsS!jsR%chgksp%fdksW&fqJJ'wS(('V)|JJ*S+H#s,\H#s-op#s-fd#s,NH#.5# /:HJKU"fdv Q HsS%ptrR5S!AsKeKU"fdv p"dirs %ofsV!HS!HR:AspKKU"fdv p"dirs %ofsV!HS!HR/@KLU"fdsW%ofsļS/H LkLU"fdsV%ptrP/@pLONU"p "expsS.Is%fdsd! sp!Gsl0LL'S'Q( ()LL* W0,N"N(=(H&T1N3N(e(p+,G$s,\H$s,H$, I$s,'$s.5$+Tks,js-nowjs+|F's-nows-exps1KAsPN}OU2p V3H3O3H5&O3kH77O32H9HO3TH<cO4@sS5AFOPU2pE S1H@as PHPU2p` 6fdbsP1qHrsPPPU2pq 5iAP1QU6p R7[X7J 7mrs  7t7.v 7ws 8 7Q7;%7 XZ7s7 Q%7R%7 U%7 Vx7W!aH/s!@H0!H1!CA;!H>!H?s%evD  #s !IHcp36gL[@Q0Hy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Zs#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#n9~%#?%# -%#$4~#(  \)8 J K%#* L%#{ M#fd Ns# ? O%#exp P%#y5 Qn#6 Rn#e5 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P #T #Xtp   ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#`?P_#  Qv #Rs#$Ss# T%#U| #V##*W #AX#'Y #`Z# [%#bo #)c#v TQ4m #ns#Sos#ps# q# r# ss#$?5t #(V6u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a N<_``#@a{ #setb{ #clrc{ # Ad{ #@e{ #remf #clog #T5h # 9i #$Bj #(P%k #,Hl #04m#4ns#8v sv s sa  v    s   s     p7`?4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7H8#>#aIe%#s1%#%HEs@QgQUn9EsS 5ES!IpQQU"fdv S!IQRU"fdsS#pos%V*@sRBRU"fdv P"dirsQ#retsPu!AsPRRU"fdv S"dirs $IR#i%P%:AsR3SU&fdv S&dirs 'I S(i%R)@&@S\SU&fd%sS)H0`SSU&fd/sS)@9S YU&p8 &exp8sp*}I:%*sd*XI?s`*G@sW*uIAs\'(I(S+X'*,+OsW,:UBU-S-Q../UBU0X+Px'(esQ,x;WAW-"S.-.7.A1GWeW0LS,XXX.i.t2XX..3 GGs4\HGs4HG 4 IGs4'Gs55G 3XHFs4\HFs6opFs6fdFs4NHF 55F3ks4js6nowjs3F's6nows6exps%KA2sYZU&p1 S'KILY'kINY'2HPY'THSZ)$A] ZZU&p\ S%Z@tsZZU&ps (fdusP%HsZ[U&p )iA[[U(p R7[X7J 7mrs  7t7.v 7ws "8 7Q7;%7 XZ7s7 Q%7R%7 U%7 V7W 5Is Is Is PI5 aI% H  Hs#ev Kj0Jint7ri 2-y&dk3C/DY76H 9 -G5 -?!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8Z!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3II!IJ( JMd JNRIII  $IElowE#E#CPsNllOIP$9IgUnfVWdfPQ'9KU_'judtpVRWlhWPQ' RPP#IUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Jm1m0 C![;!J ;\kt0Jint7ri 2-y&dk3C/DY76H 9 -G5 -?!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8Z!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3II!IJ( JMd JNRIII  $IElowE#E#CPsNllOIP$JIJ[UuZvZPQw\pJ\fpl'{`VW\DRPPXT8'P'LfiP4IUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: J!m1m0"C#[L#J L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; @ '1(1).? : ; ' I *: ; I+.? : ; ' @ ,: ; I -: ; I ..? : ;' @ /: ;I 04: ;I 1 U2: ;I 34: ;I 44: ;I5 U6 718.? : ;' I 9: ;I:4: ;I;1 <.: ; ' I =.: ; ' >: ; I?.: ;' @ @.? : ;@ A1B.: ; C.? : ;' I@ D4: ; I? < E!F4: ;I? < G4: ; I? < H4: ; I?  I4: ; I?  J4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I .? : ;' I@ : ;I 4: ;I 4: ;I  : ; : ;4: ;I% : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 24: ;I 3 : ;44: ;I5 : ;6 : ;I7.? : ;' I@ 8: ;I 9: ;I : : ;;1 < U=41 >.: ; ' I ?: ; I@41A.: ;' I B: ;IC4: ; I? < D4: ; I?  E4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U1 24: ;I 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I*4: ; I+ ,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;41 <.: ;' I =: ;I>: ;I?.? : ;' I@ @ A.: ; ' B.? : ;I@ C41D E4: ; I? < F!G4: ; I? < H4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1.1 /.: ; ' I 0: ; I1: ; I 2 U34: ; I? < 4!54: ; I? < 64: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F4: ; IG.: ;' @ H4: ; I? < I!J4: ; I? < K4: ;I?  L4: ; I?  M4: ; I N4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I 34: ;I4.: ;' @ 5: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH4: ; II J.: ;' I K : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I. /.: ; ' I 0: ; I1.? : ; I@ 2.? : ; ' I@ 314 U541 6.: ;' I 7: ;I84: ;I9: ; I:: ;I ;4: ;I <.: ; ' =4: ;I >.? : ;' I@ ? : ;@4: ;IA.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < J G src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdio.hstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hPdd9T9,V  99,VV9,Vj:Ve%9^a;dKY#lq [a9+V0co>rzq< +w 9(WVVVVVUrGr<:t=_g'Yj՜W qt8,HFGsuOf39M939M{79I979Ig-9exU59K959KsƠȎWr ՠIrdV꣜H,Kȏ.d-)-WT ȂST*9&DIz~s~GI&d8H~c@999H cU"G2yG~c~+~9 +w qw9~c~+~9@c~+~99~qV~UVe9+~UVU,zU~ wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrVddVWƸʳ~Ņƺ7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+r<7e5=|-8Vz9W=sW)-b Ȏx9.xqn=5=+oU ;%urrVg ׀8Hdh  8rr0˸V-rsU s csU+rd5 (V8:VXYXWW~ V^<d32R<RYU9U#rqq4c~9vqUU gVkU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.hPGHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.hйUd8,J:,1|8,YJJ:1n8,fŏ)g H cz91|,j8,G )g H cz91|,j8,Gfe8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8, src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h;|t*:V*,:eU,I;,qs{>>V: fsU *rey29d**V]GYԹ*Y~V  R,dW:W;G;*s,5/G<*t,z91 z?:P18,J&rGdeWtHsGo?V8, s+ UtqIH!Gj#`,6t.pHspG%:*J:8dede9 9W/GtGw;7eu+WHsl?n=Gj+9qԫ,rymcrI UdeHsff:8,:t +}G*:5rUc/4 9t+0VrhvU qFd*: Ԭ /:uU,8I,+cV qw3W<ude }+}+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg*h:*IH,l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.h@d8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӕ'5=d8dX<;)-a;,HVV;).lcz+T:;)Wcgm:drwJ,S,Wuc0dpH Tf#~9T(\x9#W2--Ӡ:Rt:s;a;H`I%;hAUdU 7WU v<8:j"OG1cO6dbdq09bS srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h@G GfU9aG@y+@ GVeu%GdS;Td;tr*d,fwqqQ=8-^G.$+hUzG?|G+(Gc+~U=zG9qxqzG?G|9e99sY*GVQqbqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:ml srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h %:ydH;Hrq:8d:W U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h0%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV z src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,O src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hport_range.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hcfgparse.hgrp.hacl.hstat.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@U~&~ U~9~~U}9 &~eV8r]*+IV8rY+2V}v4+~H~U d~~~9K6 +yUb:pdT8,p:*f GGKd:> w~9v q9B &,qH|U+8,H;)V=8V 8,  8,L;,)W9hU09Q9ddw69K9ddf8,Mo8,;)V8i98,s)8>B+ԎpGmsude8&dR:V::::z9U%xU}ƚI: r yBb-oUo9ey9dy9dy9dycy9dy9dy9jyUdp9c5df6f Ԁ,Zd{G*:/ո8ddb$<,,'⪪7Ԫr6ddfz9ddh:: fK8s)g){)d8d$ 8dk+K>) ( ) ~UAKd8,Tdr3R9.Tg\T:bea;7ecI~,d8-8~9H1t8dgGH~,ԸƸ~V:TV!9ycyc9c\V)8~-8I8cs8Zs8js8*<H.?zUb:pW:Re8,Vp:*:H8d8dW7jG&G'.8+IJ87Gb9lcg**Ht8e*r8qs8GJ'~,8dwE99wc;cr8is8bVv,d8kId8G GKTIT %;7:V8WH9U  *d:ƌ:d:Kbdb: ֎8%,d8J7-.VĂdTb:u=F,d8/Hd8C,8s8np:* cy9=`V;Phd7s w9 c8,oco+9q吪d}9I}9r}&oUoUcjNbI)ŜVVq`-8dr8r1rIstHd8x|`,d8&8}-d8uՎ8nUo+c2dx&Վ8vՎ8 d~$V8:K9 \m9qb *d8x8s*d8x8knc̀Վ8*d8EV8:wG#898lՎ88&V8X68,9d8:88f c\V   s8 b,1&rWuVd8dwUe8|V8,L8(-d8B8dVb qd_d8" U8,-aa;Ik*-);k+-Qc~Yc9q :e 9g_=5g"cl@@wm#88d8(xe8Pَ88\#V8d cw9:o9sd8d8,L,8:b8-d8M8r6dd8dI'8,Hks8I'b,iHks8I'b,iHks8I'b,iHks8I'b,iHks8I',s8b,i&js8I'ds8I',s8vs8 b,i&W8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8H'Mbrls8 Hd8yr8 %,t8xs8 '8,&W8~V8I'b,iHW8hs8I'b,iHW8hs8I',s8b,i&W8gs8o8xH83I'b,1HW8hs8Vd8xH8I'b,1HW8hs88xH8H'Mms8 Hd8yr8 =&eeUcece+9*8,~ ~Vd8GpG=z9rvs,uHd8vde8ze8 8&8,edbTd<8dd8hru9Hd8!e@9c* -{Gs8 b,i&~tV8=z9rv~8xH8f8~8}d8q#d8e[Hs w9d 8xcdv9s8$d8Pӎ8,){Id88xHd888xHd8 V8xHd8 V8xHd8 V8xHd896S8~$e7`e b;+L'IIZ-;4pd@.brpHVHsd G1 9w9dtn0t+9IxGA"NGqrk#dG39zY*GyY*GjV{:*:֪H;q8z9YU*`RxU39YUi8fT,r&y@;}:d ןf.t8fT,&'h_2a:zY*`xU39YU Kz*^;TRzN+4GL+6GOU1+O9q6 '~q6t?({9zcUrHVzRzӜ'UN+4GL+6G::8u*`Ry:p.& qwU b $,&zcoUqpqU9rrq:ry9;}x9GoUm+mc~98,V+x93y+o99yU ~ srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includequeue.cqueue.htime.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hqueue.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.hp&cJW@#re)Jj9d8V,9::8H<DUQ/+Qc uc +,d8:~G8,z* G:f:b;af ndVǢHs /3p}c*G},N+4GL+6GGPHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d   srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.h9:iEas,Sd=cc~'$#sv, G~9,~qUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zU<D%Vq 9t+ cK~HM1>@yq2~+( )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`m9n+q{:ł|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcxqO92+N+4+L+1xN+6Gc9~z|Yh zc|Yh,pxr X+~=qyqyqLcrzqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd Z0 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6&rrftz9 qwydHxqx*:sscUd;JJJol crqMnMq;:8de c"/|Gc||c9SqHHss;XJharr~VdHH5!'gQ{{G,b:b:~bh{4z(I*HHH5!'gQ m&yG:Gy+ybvU qu9ae7-;&V$':8VH;o+,8:yU8s tU=c8:9ǿ+Ir,T: GVr,T:N!rVrV,fUcqhq q,plc+GUƸ:OƸ:#rVH,,_Uhq\qqPqprpx+4>:7/JU,k}qr:T:ckDGI7-v::8e :rt:/V8:a:[r8k>rV%+8d}I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎`H8,gvq 98:v9e 9vUd Jr$+:b:;7:,iwUA+T:8:'Xb:8,d$ ~$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^"Gy+ %z^S9-9S+-9!9^!9^!+^U!+^9!9^c!+^q*r!Vi8rV8:H:8dqUA+l 4'4dpUdjmUY*Gcooco95c,6rsԀd Ŏ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrklY*G~c+~++vGE +c7-UmqR d_ c_U!q^9!G^9!9H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrilvq qm?z9hUhqFq:9q9 V;%;8pHZ,@y+@y9@⎸d :pyH=53x9<Tld28,.78;+ wU5=g*Z}s 9s9: qV;V:jy9@⎸dd8y+d8 UVd[<6/5ly9 uqe99 Ut9 9e9ce+pq}:beưyNy@Vr9~%9~9.nfrq~U<e@%Ȑ:8:gE:9Ha;&,sts:8,*=6;:7;)-b8f=) ss7- 9:8);:~ 9u99?h99h99d~o ', e:8:ct`.:8HV8=6,;6;:~80=9+:8Ԫ:7eb ct+ 9sxq 9z9bcc?b9b+9bqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5չ5=d8 ;a>4=a;7e  9wG p9UdHdb:r pcbq aqd qcHddƽb:Vd pcbq aqd qcdddƹZƀ pcbq aqd qc vȪ o9U}$e:6rrV{/rddb*;),b;7T dcKbe7-T:a3Gb + =!9"-#'oŜU@ycjn<<6mrssH9Uqm:*dvG} +9m+9m+W}c X|Ub:8dd8-7:dA)edd1C]\d<6XHr +dE@ycj,)&7-|8e}+ -?@ycj,)&7-~<|d:7V8:,tŨ:u+ qu+ 8 (<&>`<`f rc Udy/eVd7I8g6tH;7WE;u5/rb:8d8e +r88;7drT~r7*:sc Ue*,t;^>d{tY*G d87;7drԎ~I8,Ÿ{Ӝd87:;*7drdnqsc cs +s+c:*vGHR +M*:sc uG+asn*:sc,DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU n$ srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hport_range.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hstandard.htime.hglobal.hproto_http.htask.h > 9v9z9? Hf**sVFcd~e9dcn[*ddl++xU~?z9.ԜhG:IGHdHw rtc + :8,H:b 9wd@6dU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95V;96eVddH40P G;ǙfrrdpVpy92fq'Er8;U=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f|GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:<6<`VdƸ6fKdQ!i x]:rsv9 +uqJsgV|W2rsl9+kqK8cuG cfVu)LwUcrs 5/lJ8V1rs 5/lJ8V1rs 5/lJ8Vrs 5/lJ8Vrs 5/lJ8V rsq9+pqJsd*J;H.8VRd p srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.h+?Ac+?9Y9*GCc,'XY9:rs G;q<7snssdyU<7snssdAUT Gq:Y<7snssdUU++:*dvGE++9uGR  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h`;STd8d"؎8Fe/Sc+V98&U`95 ,=\92~=pcU!8,aUGG~d9~,v2c/S9-9U5x+j`% Ud m@7zq:9{U@++o+[| $#zc 'SgWBd*ho,8[?W 9%'d* v+u;d8J4h +*ed : q:*~}9}-9|9}}ӒlishّԀ"*izd Gzd G+Uqg*f+9GHR:6<~nsx v +~cV '$ 8'$ 0 6v' U#'>>zwwzzwzzP=<Gv =<Pe7bd~:b,+s&77e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g=  <9,+9jrI+v9 qGd $ srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h0)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#9,~qUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~+9~9+~+  9D}]u!GN4vpI:p 7-TIT  *7b<H?|&8:8&:RUq&|b,9UU|q8:8F:|8:8:8'|:,|9:*9d0(:p-V q=,::7VV UZrsf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzc|Yhx|Yh,p{rdT:Vrsb~~q9z%Wur +e6} qxu{qJy=:LGrycr} 9HEƎd?:?zwGG~rbdrdsz3ke}dԀdd+|dqY*GdUY*GhY*G_:qY*GdUY*GhY*jż  +<dyƨ_cf)w>9B9 n f99b 8V1c7s O197e:{HH~H~VeV~zx?wq6qq6#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.h&9::8:-J:8:-JG;#HII7;HI<b+:x usU 9T,T,+d8)),zc1sOXZPYMG f *[crH8:+(BrrP>8dtXX RGx*srb:ddS-  `.Wgrtrrrrrrrrr srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h!d:GH-, GdwɜQ 9vJZerUy+ru;xc^0rƎsz Uy+ srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.h#;9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h=cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.hP?yqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.hD!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.hpoll.hD)9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud +8:)WWS;|;);-l9_:Tif9i9 8,*z9P>TfEt6XJX R Gz*srT:ddS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hI!G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;HrtzU?HXr q~G,as@drrc?lqp~fG~q *G ńP>pdWJ6XX8VJ8YRGu*s[,GHW⸸dzk9.*IV 9,e `.*Krtrrrrsrrr srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.h@QG,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9;)H-U,TV  ;7W)7W=7+՜|4f9 vc: qTV*R<(bbc"~;;S/ 7W,}9c}cGVl$VV$p:T}f9}9 T9`qqq>ae6XJ8YRGfGr,fq!rT:dǸd39.*IV 9,e `.*Krtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.h}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$ .  f.). <.e. E.9.0.*. !.&.x..x.. %.-. 5.=. .. $.. >.. /.p. ... .. n.W. .. j.0. .6. R.. ).D. 1.=. .R. .. .A. S.. .. T.w. T.w. .. g.. .. .. .X. \.. .". X.. 4.. !.%. /.(. /.. .. @.6. f.[. 2.-. 2.0. ... .=. 7.. 1. . .. -.>. m.6. q.. j.. k.. K.4. 7.. +.. +.. +.. +.. +.. <.. @.X. <.. +.. +.. +.. +.. +.. C.e. .. +.. +.. <.j. +.0. +./. C.. 7.+..A..z. B.\. [.W.  .<.  .D. .". b..  .<Љ  '.. .<'  . . A.М  | ( : ( PR | 4| j !.8. 0|  B.4|  7.`| @ E..D. Q.0.V.N.  .X| 6 ..D. \.3.S.,. X| @L ..D. \.?.6.  .T| - ..D. \.'.6. X|  @..C.].0b..^.8| `0 T..| v   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8| T g..| (,$p $,$(  .,$@} 8,$ .:.8,$_  ..,,$ .| 8\%` . ".t\%P  .?. .. .o. ..0#..C. \%J \%`S ,\%| ?.,\%@{ ?.\% $\% .|  '7  '@* T 'p .... @.. .D 'Y a.Y. .B. T ' <.5.... .0 'd 0.0 '@z ".x ' c........+..*..L '`  _...=..H ' .%. ... , ' ., 'PS .L ' [.. <..i.| '5 .J. ...  . . ... )..t 'g  .2. ... 3.l....  .$ ' .| +Q p+T  . K.........<+`  ?...0+p  U.0+P .0+@ =.0+0` U.$+ .| 4-9 ..0-t  .0-pc .0- /.(-p\ 8- ^..4-`+ . . 0- .$-@E (-a (- <-  .x.N.X-. 0.....2..D-E  w.. .. 0-  .(-  (-p D-@ .S.:.. 8-P G.a. 0- $ .8-P . .8-@ R. ..0- .4-  %. .<-! . k.. L-# b. .. 8..0-% Z.0-`&s ^.8-( B.a.L-)T .D. ;. . .<-0 . .. L- 2 [. n.. 5.3.0-3 U.X-`4- .B. . .L. L.. <-; E. &.*. -@< =.F. G.`... Z.. .p. }. . g. .t. g..H. d. .M. Z.<. .+. .. \-PJ  1.F. ... M... S.. .@. 1. .G. a./. K.8.z.. q.8.. .. .w. *.. .. ..~. t..S. ^.K. &.j. v.T. ;.<-Pe\  ..&.-eD ,-fo =.,-pfA  .(-fY (- gY (-ge -g: ,-0hs 5.,-hv 5.0-0i *. ,-iE ;.,-0j? 5.0-pj_ -. ,-jE ;.,- k? 5.8-`k *. ^.,-lE ;.,-`l? 5.8-l /. w.,-pmE ;.,-m? 5.(-nd $-pn .| (t<nC Dt<nA M. {. .C.,t<0qx I.Tt<q .I. .\.1.$.,t<px 8.8t< y ..0t< | 1.$t<}j '.0t< ~W .| $> .<>P) %..P.0>J .$>Ѓ& .$>M ,>P .| (?   ?0 ?Q (? r (?n <?b ...0?A $.0?Њ x.0? u.(?P (?" L?   . .{.'.r.,?c %.,?  .4? . .D?0 $. .B.0.,? .8? F  ..<?p . ...8? W. f.|?06  2.\.U.E.t.l.%.+..<.;.0.,?pt O.,? c.?   .{. .. 1..&. `.. Q.. O...0?@J B.?; 0?д .0?и 5.0?p 5.0?@ 5.0?к 5.0?`y 5.0?y 5.0?`y 5.0? 5.$? .| G- G* ,G .,G .| 0HH`  R.$HH  .dHH@{  .. .v. .4.0#.. ..'...l. #..0#. .@4. .. ..@ ..0.X. .D.pF. e.=.0./. U... P.-. ]....p...THH .. ..pd. .<HH`Y 5..` .,HH9 .HH . '.\. '.T. ].p. D.!. -. %.?. E.?. #.. D.XHH*  .). s..0+..@.$HH .| <L0 f. .S. LL O.F. v.!.. 0LT .LPQ LQ 0L\ m. tLpx .\. .. b.Q. ;.X. ..0..L+ (L  $L6 .| ,HN@{ _.8HN ..$HN`? #.(HN 0HNC .0HN0  .0HN }.LHN  .6.t..t.HN u HNP  .&...$.I.4..8._.F..2.. .R. .H. .$HNp | (Qp | @Q$ @Q@  @Q`  $@Q5 $@Q0 @Q$ 8@Q  . .,@Q .,@Q L  .@Q   @Q  | $S!C .,S! %.4Sp"t 5...0S"  .| S# S#0 S# S$  S$  S $ ,S0$c ,.4S$ *. +.,S`%X !.,S%e &.0S0& [.0S&\ .$SP( .$Sp( .(S(m S)) 0S0)=  .$Sp)  .,S)d  .(S)4 (S0,. $S`/+ .S/ S/ 0S/@ .0S0 .,S0L .0S1a <.<S1 .X..<S03c ./. .<S3  .. .<S4 !.. .0S5h +.0S@6 .8S7 . .(S9; $S9 .| 0Z9 M.,Z: Z.8Z0;\ .#. .,Z;4 .,Z;Q  .<Z0< .R.0D. | ([<O ([@=F $[=S | (p\= (p\> | 0\P?_ .0\@n .(\ B{ (\B (\@C | 8]D .1. .| ,^D$ ,^D  ,^D  $,^D5 $,^0E0 ,^`E$ 0,^ER .,,^G ".,,^H@  .,^H  ,^H | $_I' _I" (_I ,_J? (_KU (_pKX (_KN (_ LK 0_pL x.,_PN- H.,_O .$_ P( .,_PP2 .._P | $Xb@Q' ,XbpQJ ,XbQP XbR2 (XbPRt (XbRc ,Xb@S .$Xb`S DXbS ..T.X.,XbY  K.,Xb Z  .$XbZ( .,XbZ2 ..Xb[ | (d | ($e totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavail__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgosrc/haproxy.c__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnputcharbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognameforce_persist_rulesdowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authnode_copystats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_namestats_set_nodeout_realmstats_add_scopestats_set_realmstats_check_init_uri_auth__lendesc_copyout_base64ulistnew_nameout_ubase64stats_set_descsrc/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sun__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.chex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_strst_sizeatoiforce_persist_rulest_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalnew_leninit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportnew_ptrcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uphttpchk_build_status_headerout_errortask_newsrv_hlt_stprocess_chkfd_insertpc_endevent_srv_chk_rsv_statependconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledtick_addsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterratioevent_srv_chk_wsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrv_dynamic_maxconnpendconn_addsrc/queue.cpendconn_get_next_sesspendconn_freependconn_from_srvinit_pendconnprocess_srv_queueget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportout_free_sessionladdracl_testsalensrc/client.cmax_setpatternsacl_keywordmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchbuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_closeout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockfindproxy_modeproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxmanage_client_side_appsessionhttp_msg_oodhttp_msg_rpbefore_crbuffer_abortdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrret_ptrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdracl_fetch_shdr_ipbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiepathlenquotedhttp_msg_rpline_eolacl_fetch_chdr_ipacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverhttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valsessid_tempother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptracl_fetch_hdr_iphttp_is_tokenauthenticatedhttp_find_header2http_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntasessionreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirectnext_responsehttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcoderesync_namenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrprst_rulehttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshappsession_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_erracl_fetch_queue_sizeprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queueacl_fetch_avg_queue_sizemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serveracl_fetch_be_connsrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdacl_fetch_fe_connbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serverssrc/stream_interface.cstream_int_returnstream_int_check_timeoutsstream_int_retnclosestream_int_report_errorsection_typesrc/dumpstats.cultoaprint_csv_headercurpxstats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafterfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_match_subacl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_strtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01BT h r S a  l ] x P' I Pl t Xi  EHKSsGf=\&PSYx#1E&0<j@GmpsypsyTsuIA C P c q s | Ni$,68BG^4vAFchQY^h T }E1     W |   4_/z(JM[FW\_QVsaiCm""!" \b""!!\&&K%r%%(%K##OPOO%\&IOOhN}N&&%%IOOhN}N%\&%%**--,=-*,UDD==Q=|=Q66u5)64 5-/U11113P3S3^334DH=UD<Q=)6Q6 5u59:>;t;:;>?BB@A>>>>?@BiCAB??@"@ EEEEEEE FZGGGGIJJK~ڔSDY1y%;@UWFOFy%19~Ŗӗpvp7_l@_x(0&ߨsɨxnDƤޤG7DlG7Dlfqtv eflE ;  @ H K E [  Q X `  ; }fV:Xp[p7pfy  7 e +&9n9Pn9P&7 o P rPc06cySfNP -G " GZI O -] p U W y&Zkqv~  D 0&%B _ ] i U W H T o    V \ $Z"+AAINdNf#qv6u "  `!!!!!!!!z!!!!!!!!#$8$%J+d+r++++.#.2,M,--,7--.T///D54114441:144=1R1X224h4244D5h44h4444J9d9r99 :c:Q@@3@>@^?@>>"==:<o:r:i:l:;<p@@<<;;@@;;d<y<?@<=>@Q@@3@\?^?>U?=>=>>@Q@@3@\?^? ?U?>?=>@@>4>>?z>>>@Q@>>3A8ACAIAAAEJOEJBEF2FbEECCbEEpGsGGG}GGH>IMSNPQQjjxjvggg/gef=dfdcc``[__\^XY:XYXQQWPPjjxjPLQLQQQefcc``__\^YYT/USSLQQQefcc``__\^YY:T/UfRsSYYXbYAUkVvggUUYUvggcUkVWWYZW:X?\\xjj2j + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_'*xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh07 ?(( `GoTo\\@c 8l ԏ u%pԒ{42JK  ttt <   !!x#\ `\/ \/ tMQeŲƷ@lri Gm- 2 9 deF0H SJQ W ( e@ @8'v 7 04Hh(\ԏ  Ԓ   t` !"#$%&' (/Ę >I/Ę Ę tx   !.p<H >^/ (ȯ5 (82=HnMPR`Wags 2   &1 >tDGR[dj u   @ 6 @L -  `0  `S *J 8| F@{ V f t|p Y   TT `  'Pe\ 6eD Efo TpfA bfY r gY ge g: 0hs hv iE jE lE pmE 0j?  k? .`l? Am? Snd bdp a  0i pj_ `k l pn nA &3CQ_iи yp @ к `y y `y  0 Q 3 r Nn gA Њ "   P c      0 7  F Y |`e ` x       +  | px @T T  T / 6 C M W c $ o w @  `  5 0 $    L      #  #  #0 % `2 &\ = p)  J 0L W 1a f 9 q z h       c D$ o w D  D  D5 0E0 `E$ ER G H@ H  H     p I' c I" o  I    % J? w KU pKX KN 4 LK pL =  PN- O P( J PP2 P S _ g q x   @Q' pQJ QP c R2 w PRt Rc @S 4 `S   S  =    Y  Z Z( J Z2 [    [ @\   \" , \" B \< R ]k f E^ m /H^ y v~ @wH /a y y8 Dz Tz   a/ c| Xd d *e> ;f\ H(g@ Uhg kXhF zhO h] Pi\ i2 i0 j ؅t L ,  / $,Ə4v >! D/ S/ _/0 m/0 0F / "= b 0 C p^ #; /pc EO Mrh^ j@ |K   @.ش* ' `( ؊ "` '; 1d <('H5 Y2 _hй H@) .  ;/@ ^1 @-p # .@ =O) X4 i5h x1 $ 0;\ Y]; 7 t$ @)@+  x$ `:> H) Op VM ^ t/@C     P p( - t &5 4D KдV  f0S rP) =H@ T v  @( 8$ 0P ܑ"6 (79P  I`\- \" szMp  P?_ P ]/  ^//@- "N /px AS`3 \ e` s`Y  ' @v D7ܗ@r(  '@ A0 J( Xp j% @=F ' I# `w 10K  !nC (7 6\  B Of Wp"t g  w@z    ' 0  $  @) ' 2PO GY c`%X q ~p- 0C  x 0qx %e :I  ;J )@+ 5 G:[ l4y)4 Z 3 1  y :k =S `-  P $ %57`U GđY= iPR v/p P `4- _ @1 `? Љ 7 5PP ?C V ex:   д 3 Ѓ&  ;`&s Q (/ @0$c N u b@E p:p: `Z $ dh p  : / $::` E3V \ԴgB{p\ H@  '  .P( "71 0" #A3 CL{ c' r  (m  / : 7 C  2  7 G $ 0 - A pt W $  i p v @,  0) @( @z P 06  Q 0 p !$  !)!0)= 7!;4 C!B P! W!p i!l! !0 !) !`/+ !@ !4 !p !H !@{ "`= " = -" C" M"} ["!C g"9 w"<3"O"") "p "" "@#@0#*# 7#9; I# X#p_ `#p$ m#) z#\# #` #C #= #\ #P #J #t $@'$@1 <$Y$x6 k$9 w$W $_ $0,. $,$9 $A $d $P %PS %P (%@ 5%)d C%S K%b% m%{%)T %] %3%* %:%  %8& &#&0 %&q7& N&ؗ]& j&`3s&c&:&&&`5 &$ X&X&H^ &t & B{ '0 ';''+'h C'bT'3h'` v''=' 't'  ': 'ȴ'' '' (;Q (^1(@  :(SO(@n \(0& j(3 (@*(P(((E ((`+ ( \ (@{ ) ) -)0C :)@} H)pQY)@' a) h)@p u))) )\)@6 )))t)5 ):)$ )@< ) *03c *PI 0*М F*hX*@J o*p*`A*u*}j *:*t* ~W *5 * +PQ +A 2+=+' C+TS+L]+ ' <h+|q++ F +P8 + + +X+= ++̴+( ,5 ',E, M,Y X, 3g,7 ,,0< ,<O ,0 ,;,! ,F ,м" ,@# -  -0` 4-   ?-DT-! c-:s-\_ {-/--$ -g -  -`' P--q -Ĵ-:. %.PJ :. ) H.X.t<a.m.  w.j.` .3 .@. .$  .P . .@* .9 .P /=/x#/ 2/3 D/N/\ ]/g u/) / /$ / $ / | // /70 abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidscfg_nbcfgfilescfg_cfgfileoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.2sa.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerdefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_chdr_ipacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_shdr_ipacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_valacl_fetch_hdr_ip__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_rateacl_fetch_fe_connacl_fetch_be_connacl_fetch_queue_sizeacl_fetch_avg_queue_sizerecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleunix_sock_usageenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroyinit_default_instancegetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlinefindproxy_modeeb32_inserthttp_capture_bad_messagetcp_splice_initfdtrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserverhostnamesess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0manage_client_side_appsessiontcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_mallocstats_set_desccfg_parse_listencheck_config_validitywaitpid@@GLIBC_2.0acl_match_dirunix_sock_usage_msgparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0str2sa_rangea2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requirestats_set_noderegcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingurl2ippcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info