ELF`4{ 4 ((%44444488``(``HHH Ptd__Qtd/lib/ld-linux.so.2GNUahV@c,dL)NB>(&M/8`[KZbTUY_e96H<If aW4EX 1A Qg3$^S;]O "!'2 #*.0=C:?7%PGRJ+F5-\DK(=H1;`Y o/u=H0A7gM//vD7IW1{o@b*:; :Z:5/%7q:;]:C$oP(oW:3B5.AQ7,o!OW, , h,3L:8#q@c-:8XG* ;b3,b=^S#(@ <:hy0ouO:i4oG;DJ:+ 8/t: @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii 9ii Cii Maf o$o&(o',o30oS4oVaaaaaaaa a a a a aaaaaaaaaaaaaaabbb b b!b"b#b$ b%$b((b),b*0b+4b,8b-tb?xb@|bAbBbCbEbFbGbHbIbJbKbLbMbNbObPbQbRbTbUbWbXbYb[b\b]b_b`babcbdbebgUS[?[5a%a%ah%ah%ah%ah%ah %ah(%ah0%ah8p%ah@`%ahHP%ahP@%ahX0%ah` %ahh%ahp%ahx%ah%ah%ah%ah%ah%ah%ah%ahp%ah`%ahP%ah@%bh0%bh %bh% bh%bh%bh%bh%bh% bh%$bh %(bh(%,bh0%0bh8p%4bh@`%8bhHP%C^HUtɋC d Sa9sLs= P؃u P1_^S$_YR_$!t E WW0Vh̠! P@ hDosLo$ci P@VP$cPE Ph XjmQQPP,cPE RPh<v Y P PchhAPVVhgPE& 4oQ'Z$oPX(oP@c8cQM RPh=$cM PW1VhM SS Qh t Dou j PPE PhXM PPPh4몋M PPPh|= cM PW1VhS@tE RQhHb LcSQM RhpmDou  <vPPcPE 8Wh뺐USMAҍu1[%]Í'US]E Ch@‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPP?tC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PGe[^_]ÐUVUUUWVSu M]~)<;}|o{1%@A% Š@1҈CQA% Š@C1A?@Cu [^_]Ê%N@t>1ҊA% Š@C1A@CC=C1C=@CېUSQ]{t]Ë9| C]RRjPhC]Í&USP]C~ t C]PPjPl⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P5/C1]Ít&PPjPlC뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU deEPLHP@L`ede]Í'UUJLBPABPBLBPBL]Ð`eUV1S=`eXtC0uCLX=`eue[^]à SЃ ƋCLݍ'`eUV1S=`eXtC4uCLX=`eue[^]à SЃ ƋCLݍ'`eUV1S=`eXtC8uCLX=`eue[^]à SЃ ƋCLݍ'`eUV1S=`eXtC뇍&E ;]%uve[^_]ÍE9sJ'USMEut[][]4t&[]Ð&USSS]jnjh`o5$]@lvQjkShz`o]f`oRPShbo`o]Ív'UU0 vv %&]Í&'USMȊt,0oCu.t:t _t-u Au1[]É[]Í'USMȊt*0oCu.t _t-uvAu1[]É[] UoVSo ]ooSÅtePPj:S1t@jj jPƊ<*„ Шt7of fofoS8eo[^]PhoSjKu St@oPPSh̥m뎐&UWVS(uV ǃ1txEU SSj/WÅpQQj.VFtCERPVjtRPE PWjtB WI؍e[^_]ÍvEjj PV{t UtF:tA1à Wt@U 렋UPE PWjuà wt )ȋULE>'US1ۋU t&ABHЃ v[]É'U1ɉWVSEE]߉f@f@E 9vj1C9//:%uف//:u;Kt&UF‰U9wE E}ptthte1[^_]Íe[^_]ËUEEUEEE߄uDʋU1B=wU܈EuE@E}Et_GqЉ ƒ.%uA< vE.…%I}?E@E܋EE뛃}UE)߉H øP;:tfUfBCS_損t&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPEƃ1tPSWVe[^_]ÐU jhh 9=%Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSR,KC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPBN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVSu]}VM SE)ȋu)ƍ19r e[^_]RC)XP7WP EPEPE P]C;E wKC ;E vC C$;E vC$CCхu;C(r e[^_]C뮍t&v'U1ɉWVS u]U )Ћ})NjS9s SڍBX9s e[^_])PBXP>VPEu^C;E vCC ;E vC C$;E vC$CCхu;C(r e[^_]ÉPEPEPE P닍&'U1ɉWVS ]u} S9r e[^_]PC)XP7WPFEE…%udC9wIC 9vC C$9vC$CCхu;C(r e[^_]C밍&PEPMQW7E D y&UVSEu] PMQF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EEE]WhEP G$PG PGPGPGXPh@EPu G9EvEMQSh`UR;]}3ރtvPD;XPh&EPmt2C;]|͋EEEE E,e[^_]G냋EH9tPPuVj eC봍vPSh1EPPD;XPh&EPwEPjjh:F믐USD@ct0tfEčERRPEP, ] PEPEPEPEP(ohPe (oS]SQZ(oPu]ÐUSD@cttfEčEQQPEP Uȍ] PERPEPEP(ohPESP(oP[ (oQ]ÐUSQ@c]ttERPE PSH$]ÍUVSuPPeVP,tKye[^]Ít&'UVSuKxPPeVPue[^]Ít&'UWVSEE u]=tEDf|E 9D)|D)D);E }E »ott dd0gfffttKttU)ʉttow)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh\t‹ tuȁ?BEU;%PEhP~E 9E%EU Mb)ʉҍ)Ѝ£e[^]É@B@UE;4;)E9FRU ؅t1PhVU)‹E +x:tt#ttEU@BtBtUWVSEt]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhP訳et[^_]ÉڹQPЉ )ʋMRhèQjU‹EHUE%&E.P)RhǨht&tEEvڹPЉ)ʋMRh˨Q޲U‹EHUEft?ډ)US]S|$(tDXHx4Ћ (tȀxu! Jx ʀ8t X]ÍvUWVS 1=$t9}-1PPEP4Pcu ǃ8F<9|Սe[^_]ÍUWV1=$t19};tF89B8~A<9|tF8t VV$uF8te1^_]`e^_]U$tV1S9}1F<9}"tS8t FSS($t<9|ލe[^]Ð&UWVS EPjjhϨEEE $t19t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<998uP4PEhPޫ8MQj jh;$,EPjjh~E@EPPEPCj í $t<9cv}19} tUB4u$tMPVSh4Qe1[^_]Í&UEPjjhriRPEh)Pڪ'URRuà h`Ѓu h`1ɉÐUS4tt'B 0t4t,tHC,t0tЋ]á0t190c~8ttLJ AJ 1҅t̓ EP<x8ڋEC CEC0t@0t뒃 Rh믡8tP JP 1i&US]CPyXKQot8tP JP 0t]H0tÍv'UUu&4tB ,t@4t,t0tH]0t]x&U jjhYL8t0t,tÐUWVS }u}t<\tFGuEe)[^_]F1ҡ0oDPt50MFT~~ӋM )RSPW$߃듐xtFGF,oF 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡ0oDPuHxtVVPh`{1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjjU PUp Pe1[^]ÐUWVSP\`8`dRRj,PR`t @`PPj:dP蛩Å PPj:CdPzUhPhjRK pfDžh PdWj : PPj-S赥W@jj jP:jj jS)Ã@=G=v)f fFV AC 9cPPhja hƍ@ hRPKFfh uf fFV뎍`t`8[ \Pe[^_]PhhjPdfDžh<*„ Шt+DžlPPj-S^jj jSPlPdPj衤g dPtl@l?SSdQh\ZPe1[^_]PdVWhhPdPShhQQdRh1PPdPh̥뤐&UVSOM ut~,Ztwtt1te[^]û܍v RwUt,RSRPuV]SMQhMe[^]ú͍v'UPP1ɋEP89P8tEM PEPQh UPP1ҋEuËEPEPE Ph<É'UPP1ҋEuËEPEPE PhÉ'UPP1ɋEP@9P@tMEU PQRhH UPP1ɋEPH9PHtEPEPE PhT UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًMSVWQ!uƋUSVWRNt뱐t&UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًESVWPtĐ&UWVS E} u]SVWURktEEe[^_]ÉSVWEPuًEe[^_]ÉUWVS|E18tu@c@c1ɍe[^_]Ðt$u&5Td1Ƀ5Td=@c1Ƀ=@c t' u, Td Td1uTd1ɃTd_uTd1ɃTd8 uTd1ɃߣTdʭu @cЭu7LdUB8bjj jPs1ɣLdu7PdZUB8jj jP+1ɣPde1uu1Ciu1Cdu1CuR5 cUB8jj jP͠1ɣ cSE }PWh11gu1Ciu1Cdu1CuM$c;UB8Djj jPU1ɣ$cPE PEPhWu? cu肞 E@PktI@"EP$$ctYPE PEPh,_3VZYPW^USEJU QRPhlj՝ E@P~tP@un(c5UB8jj jP1ɣ(c@__3VFZYPWM^USEJU QRPhG,cUB8tvjj jP臞,c=@=@t@ h@PE PEPhm 1,c@~U EQRPhTFr2] MVSQh,I u30cUB8tjj jP˝1ɣ0c u8=8cUB8qjj jP肝1ɣ8cu1LchUB8tQ P Lc1z uRPc'UB8t% PߝPc뽋PE PEPhȶ}PE PWh1lu1Cou1Cgu1Cu+UB8tB8uzE] M0VSQh@p($=HcUB8jj jP?Hc2uPE PEPh PÅ~UB 8>U1B8UB8/ fDžxPxP|PU@ Efzu fDžz=Tctp=XcuTxRjpPhcXc5`c=hc fDžxP xjnPR˛PE PEPhԷxQjpPhlc蟛Tc5\c=dc PCDžE} u@PWVh[B PƅE@ PE PEPh<ɋUE RRPEPhp볋E RPEPhO] MVSQhܸmPfPftC tރ~t3 F uۃ EhPE PEPhEWWQV R蓗u UhPhTh^hʚEh^hjjjPV |$M] hSQh6 1} uhWVh6QU hhDjh`tLfxtltPvvwwuuuuttttttttuuuuttttuuuuuuuuÍv'UWVS\LEDž8t, Dž8DUB8+ PȸvPPE=Ht@PVKul". tS Z}YPGP P} uPWVhtHt HtSSShhDj葘ãHtY ȸMC0 C4C0C8ǃpC aUD8HHt%} tV迎;uӋDcDcU;j4cB4c1 xP_5tuV |u[QZuPXuPXuPՎX=tWȎ^vS軎YlvR讎pv ňxP苎@~q1Ht`tv}PE PWh މwHtPP;u鋽Gk uQMQ:t&PPPRٶ}PE PEPhl2w uIEXB1U EQRPh1iu1Cdu1C`t;MA8Y;jj jP0`Ht`@ȸ&9t`9`u1E RRjSPEPjP 1҅UB8DHt `W"M HtqV]d@Pj }`HtdQWR`PӊHt`d1_PPEj} uHtPWVjS 1҅2HtPH!1҉H ui1G 1tu1Ccu1Cpu1CuX1APE PEPh1@ xD>1GO}] M7VSQh/ PPE PEPhH}UM SQRh MDžDžq>3 UUUU@E:1au1Blu1Blu1Btf1ou1Bdu1Bdu1Bt= gE }SPWh̻DžHt1҉l1au1Ccu1Clu1C`tU JQGucHt0SSPEPI]}U EOQRPh!}PE PEPhDM } uQRPWVhEu ]8WVSh̻޿14 3®`ʮҮ`tEX1iu1Cfu1Ctخ8uWPQ0PEP"tV} xHtP }D8TDžCCE8uHtW}0VPPƅ@E FPPj(jwÉpXP资 CP賃 Ct8 W蔃C 2 QaC$Ht[S PDSP@UK{ XDU }QRWPUPPjPE PEPHtjP 1҅KMA8yjHtj jP1҉pPPEj=HtPE PEPjW 1҅UZ1MA8Ht PR}XHtGP4 PHtPP) Tjj jGP!XHtX?~-E j?PEPh蔼HtǂX?1ҋ1] MVSQhǻK}w3=Ht`tUB 8t4R1lu1Beu1Bnu1Bu }G8u'E PRPE PEPh$@PPjj}áHtUz XW豁M Cq V诀 }Cjj jOQ觀 C @jPhCHtQK EMS] 0VSQhHg NEp6=Ht`tMA 8t4Q1lu1Beu1Bnu1Bu }G8u'E PRPE PEPhĹPPjjáHtUXB PQM Cy WO }Cjj jwVG C @jPhWCHtQKU ] MzW2VSQhH EU EQRPhU EQRPhܾǸMPE PEPh觸9u ]WVSh(芸 PB} S C$RWP~C S$; MaDx-AgDe=0s s } M] P7VSQhx1#}D8DžUUE RPEPh軷 `t}RRjPE PEPjP 1҅G8E@‰1iu1Bfu1Bt%خ8Ht0RSPE PJƅE FpFuWWjj/~UÉp^JQm}[C HtPLSXLH1҉}PE PWhw}] M7VSQhWsPPhpVtPE RPEPh,蠶JPE PEPh!M] 1MVSQh̻Q * EX;t/1UWWQRRyuӡ@t/1@WW}QWRxB@uӋU# 1E } uRPWVhx״ }D8tmCDžMPPjAPE PEPȪPHtP 1҅}u~HtĪZ ÉZ1_U ES U QRPhx8 +uh}D8t5CDždHtĪJ!JzM PPE PEPhx蝳8,}D8 Cjj jR6y-- PPE PEPh$@PE PEPh#PPjGPE PEPHPHtP 1҅}uHtDr Ɖr1HtDZ!ÉZ=u= kE@PE PEPh,Ok8DLZb ]m ' YYQ$y$HtbvtRjhxPwE=HtDžpLJ >LUD8PPPDP藡Ht‰!U;`MU EIQRPhl艰 YY Qw$HtutRjhPv E=HtDžpLJ>UD8<PPPDPRHt‰!U;``}PPu ]PGP?WVSh5QމqUD8+ PgvXEHtDPuHt Pt }PPu ]PGP?WVShqމUD8 PuXEHtDPtHt  Ps ^}PPUM PwVSQRh譭} u ]GP?WVSh膭USS QBPPE PEPhVr} uGP} PWVh/K Pt Ht}A%@A?E@ 8tuh P[r_VLrt4$@qHt EYP R@PhV W0s$ 9 jptVjhPr Htǀ$EQQjPE RPEPHtjP 1҅Ht P/sHtB% BMPPj} AuHtPWVjS$ 1҅Ht Qr=HtUG% GB8}w > Pp4$pMAZ8to Ppà So HtXZUB8uMPy WqVhɯS Syq$DZ뚃 P@pp4$5oHt Wh֯V Q-q jntRjhPp Htǀ$}PPju ] HtWVSjQ 1҅Httt PPtB Bt} tUPPj=HtPE PEPjW 1҅JM] 1MVSQhp莩HtPPn}PPjPE PEPHtjP 1҅G8"Ht P,R.pXEHt@P[oC, }u} PWVhMRRjPE PEPHtjP 1҅o=Ht`ttu9\u LJ\EXtt%uu1Cru1Ciu1C!MA8!RRP\PF}PE PWh訧U}PE PWh舧 '~`tNMPPjPE PEPjP 1҅=}w/E@‰1iu1Bfu1Bt!خ8uJHt0QSPE PtQU PHtlQl h1҉} u ]GP?WVShDGcE } uPRPWVh 1iu1Bdu1B}D8jj jPf=xȸ@\t9t ;x苅U?Rt8fufff{{Ct'HtpdFpdC1҉C fDž HtH`AH`׸1liotC y 1*OuXSSEA<= MW] VSQhHo~?  UD8ti PfdM 2Ejj jLQJcfUu ]WVSh 7S!um54cDžF54cFPjPEDPi)MbGEUD8"S SPMS\PS`PSd@ Ch 9ðE|?ʰssDcDcU8gPPUPPE jPEPhds U QPERPhKg ѰKKGE hðPEPhEjj jDP`CðE|?lʰ%HtHHDcDcU;q1+ P~ÅUB 8mU1B8!UB8/ fDžxPKxP|PU@ Efzu fDžzHtu`xQjpPRYHtHt fDžxPd xjnPR~Y녋] MVSQhԷxQjpPRHYHtHt PDžMu ]yWVSh|$Y P觓ƅ}MA PE PEPh<ËGPE PEPhpG`tMPPj} uPWVjS蜱 1҅}G8PPj j1Y ËEj@PSuwjjHtSPխMPE PEPHtP茳 1U PERPh(\xMu ]yWVSh;WUBPE PEPh6U EQRPhUPE PEPh̻ݐ`tEQQjE RPEPjP@ 1҅UB86WWj jW MjqVPjjHtSPuE Ѱu5HtPPu ]hðVShHt C CP_PP@ U aމUD8 Htt PV=HtU DPUHt WT 5Dc5Dc}U EQRPh辎}QQhðhE RPEPh蒎] MVVhahðhSQh8g}U EOQRPhFbPE PEPh)E}u ]?WVSh̻ %p`t@MSSjU EQRPjPl 1҅}G8PPj jU ËEjxWSjjPE PEPhZvCufff(Htt#fx t=f@f%fPE PEPh f@fPE PEPhDɌUPE PEPhp袌}PPj5HtPE PEPjV* 1҅G8=Ht T<PSXEHt@PR <Ht<PQ U@jj jB PQ MDjPAP|HtHQQhXPmE RPEPh萋鬿PPEjPE PEPHtjP 1҅UB84 Ht QRMZHtAPQ=Ht PPDž Ep>tW =HtGGG};uHtQЃ H!Ш { Ѓ4H!ƒ4E RPEPhSo} u ]?WPVSh,HUM SQRh4+UM SQRhpU} uPWVh҉Ejj jTRO?Ejj jLQfOE DPPU CtVOCE DPOU CDPNC jPP}PPE jPEPhd U QPERPh輈ؼPP] W}4MVjSQhd芈馼 RPE PEPh b~}PE PWhGcU RRPE PEPhp;?u ]WVShUE U QRPh̻U] MrVSQhݻPE PEPh複U} uPWVh̻脇頻 `t`PPEjPE PEPjW 1҅NUB8RRj j|N MjAPSLjj u1I7] MVSQh訆ĺ1iu1Gfu1GخDžC] MVSQh%@PjGPV=HQQRPt>ƅ@H;tW@A%@9 P[%p_T)GPu9_TtG@t BBǂhǂuv DtDžP$XW#DtRPPEP(uPWVhP}t7u3C0PF PPh\C9 tS6YR}PPWh& Q6RPEPh\FG f=ȸtz @t.1ҋĪGt5Dc̪ Ɖ5Dcuԅt.1ҋDGt5DcL Ɖ5Dc@uԋu DtP"1Dtuu|u uDt9uu|u u=xG7 LJ$j jhP>! QjPh^蠑RjPh^xp b{uPjjs Vs9ƅ9 C P~!l1҉s tl ‰lPjGPw,V 9Å&9D G,P+!l1҉_,tl ‰l5G\*PPEPh`[Y@ W->/ W G w Wh W ]VVSW9u %GtS%3YRPEh4Ph Y MVSQh Q2]VPSh,CXAt}PPWh]VVSW8tu2 Ph2RPEPhWF_\m tQ%2RPEPh4 X= hh'PG,PPhaWzPC PPhCW@ Q1RPEPhWt&PF PPhHF tS[1YRPPEPhV DtP(DtSO,QRhV@QS RPh tQ0 RVQRPEPhLV| tQ0YZV]RVPShǃ tPV0 VQ]RVPSh뇃 tV0ZYVQRPEPhpRUTfEPPfTf]ÉUEPQP@ ]ÐUMAt9}]Ë)Ћ]ÍUUJtH9ttu]ÍuދܐUSá$@tQ. RPhNTXtP.YRPhjSU]ÍUWVS x@P@E9t]2 69tOZC@tC$ C$R[C$u S4]C0@6C0E@9EuEe[^_]Í&'UWVS1 tn1Qt&FtVtLX P7[K$u S\S0G@S0F,t V49re[^_]ÍvUWVSƋ9t;F ƒރ FUFV]E耽XZPFEFQuPhh^SP  F4PF$WPFxdt H`tRPdR@`Ph h^SpP(hh~R}thhhj^SSFHduP`tyFt udže[^_]hhj떃 R@Phh^SO 뀍t&'UWVS Ƌ9t%u9|He[^_]ËNAdu y`m9}Ӌ)߉FƒAFAit!8& ]VE耽XZPFEFQuPhh^SN F4NPWydt Q`tPAdPA`Phph^S>NhhLP~hhjWwQ FtYuc$9})É؋ É $d VЃN R@Phh^SzM Vv'UWVSËHu H@SE耽XZPECQCuPhh^VL C4PWCxdt H`tRPdR@`Phph^VLhhNhhjCPOC xdup`tTCt&ue[^_]à R@Phh^V#L 8&륍t&UWVSËHu߉H@SE耽XZPECQCuPhh^VK C4PWCxdt H`tRPdRx`Whph^VZKhhhMhhjsVN Ctue[^_]à R@Phh^VJ PvUWVSX5IFCX5Xe1[^_]PPj:Wl`A룃 RB RB QB) QwBK,tP JP tp N8p sI sCBC`P JP \POe1[^_]à h 붃 h à hDx l h鍶U1WVS\M 50o A1DF u1MtM1DF A150oA1DF uGLƒ%붐LG~ud18u`]iubU:EUǀxB0@<QQPRe[^_]AS`18uE8EǀUB0ǂǂx@<QQPROE8E8Ejj jRTUjEj jP9UEjj jPUEEǀx@08@<@8VVPRnjj jPUUWVS ]u xtt e1[^_]ËS,PBzXPj WtPPWSt.u(u$u V8 t)ʅ~ u @뛋C08@8ǃx1F4e[^_]Ðt&fS,ǃxfǃ@@t&C,p4߉p4ǃx1e[^_]UWVS EU@@B0EUZ,J0$E9MAD$EH0EX,CL83E uE1EEpt6CL8v̀C4%1ƉptEC4u'CuCC,C4u u CL8ЉU% = %`=@%` = `@E1ЩptECL8EUJ0vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@}%` = `@}1ptEUZ,CL8E9EQP U%%B4B8BDBDf uC:A/&Sstׅt)~t&Qqtхt)~t&ʅtt )ȅ~ʋMQ4s4t[8҉t хEʉH4EHHt˅t Љ)ȅ~ˋUZ4Ee[^_]è C4 C4Y,A)9s)Q0A,0C9C,rQ C0=K,C)9s)S0C,;Cπ;C,몉)؅' RQUZ,J0HUQQSRtt{MY,%*/&uWWQVQ:tF;ur~;}s!1F@tG;}s 1@u]uU)ЋS9uPRCPEP赳uҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWRCUM]vE U1DUDUEfDf%Ee[^_]à h5룃 Rw#C'UWVS]u} UCM$B91@tЋ^0))؉F4N)ȉF [^_]Ðt&B91@tꀸ@Ћ^()B)ػ F,9s|1@u\)F0낐B91@uꀸ@Ћ^ )B)ػ F$9s,1@ur)F(g@tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0@tB9o 딻덐&UWVSE]UM}$B91@uꀸ@u )K0)ȉC4{)C [^_]B91@tꀸ@u )s()BC,9ʸ1@ugu )C0jB91@uꀸ@u )s )BC$9ʸs31@u[u )C(U@tjB9zu tM t1[^_]øٸҸˀ@tLB9r붍vK(u ))ȉC,} )C4C0@tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$,:؋M)CXG9sɊ1Ѐ@(C9r몊1Ѐ@tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB C9_1Ѐ@H uC9 ECUX$G)ЃXGG9s WBW9r1Ѐ@uC9r}_ uC9e uKC9P1Ѐ@uWMA PQ: %PO)R MY$ MXMEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ@ uC9[ =C9B1Ѐ@SOEDX9VUDX G@GDX97UDX G@GDX9r@ C9; C191Ѐ@tUXU9$_G @V 4C 9R; 6C9;1Ѐ@tUXU9_G Mfyt tE f@ f@f@WEЍPXWG@ @؋U)ЃXG@M EY$jjSPQEUGà rG UM EY$jjSPQnEUGà rG C9C9f1 'UWVS u}UE UV EG])ЃXC=^v^F XQPR跨F@xWV )ЋC SUCCECESEE Ue[^_]VV G$)ЃX럍t&'UWVSLE}EE \E1UMUIDM1ɋ]9EUM@,EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿LC9]s]]UZ t@MEȋUM\XDN9r&Ẻ ޿PC9]s捶UEЋMU\XDT9r Eȉ޿[JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh`脧!U1D\fDf%ƅuMYUor}&U܋U܅M܋QB9uEypу9u΋U]K0fǃ@fǃ1C@1@DA<`PPQSwe[^_]ËEEt&ME耽VY gSQh輦]EǃXEZUPB,xLWKMA,@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8t)Ѕ~ e1[^_]á)Ћ MbLJE))ʋM>ʉtWWjS|ZYPFLPКCF4F8X\C$puPC$R C$e1[^_]ÍvUWVSL}GW< DBUԋU 1ۋB]ċ$E؉MEPPwVjhw ]܃ }M؋ERjhP辣] uE[]9GE01ЈU@uqv ҉UR,oM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ@tMԋ]M9sNwEƉu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjhQ>E0'PEjhWPߟuUωPEj hP谟tˍ&PEj hP苟ًUQjhRx3듋u)MSjhQLxUB<"<, Ш^Ev'UVS]u fft>fHtUǃpPPjSZYPFPPC$ptu C$%e[^]ÀPC$ٍvPC\PVS螭xe[^]UWVSEEM EP$ыUf@%ETTXUM EMPfDf%E܅<] f%41GD0EEUjhj SBP2 u?MAw4$M]ECHLtUM܋EM%1e[^_]Ë]C9CuыEًP I,S[0AC |AMpA BtBǁ`6EEUB[]EK ujjVS] SM] MMQ0‰Q0IfWf% ЉfEfH Eh@ PShxM $hVSQUƒ fUUz0ljz0]Kƒ ШUWVS ]}u_O1tLs$E EX EƋK8ΊEUjhj RGP0 tUEe[^_]Ít&Gw$UB9BuҋMW Y0QI,C A|AMpA Bt ǁ`E뉋MAHLҋUBيEhG PEPh}M $hVWQ_S0{$ƒ S0U DXMSjjPE QXjPCPƃS f‹% ЉOƒ Шu 1it&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWx|uPE SPW&UWVS|EEM EċPhыUf@%TLXMMċQfBf%Etcu}}Uf%481Bj hVWD0E…u,EE}ċMWfDf%Eue[^_]ÐMċ}}u< E‰U9ruu듋Uӊ<;t<=t<;t C9s<=u9tր;;tэKM9tljMs51SЋ 0oDA u!;t}G}9us}1DA tߋUBPt&MċuuM)΋Tu9C؋Mu);[u<0ًU)ыu9ɉU ]ȋP;Hp cz Gz t}GRDPEPQ訕GDCXZPGHP賱ÅMȅtHP JP Su,L B @B KS:MA1ɋt |C K@C MAP9u׉EċMt uFu}G$zE@m E} jjPEPWmUċuJ}fV f% ЉfEċufH HtـuHt9u׉Du B @B Eĉʅɉ}GX;E}Ƌ}PVWR蟓Uċ0MIM=z}WVQR_:P Tz Gz ˅EȋUẺAA QQSBHPBMAA B @PBPEPEPE P}uNjU}}fMwtƋwt@ ~  R= R* h MhjAPm hTMăH R" R J QBPEPEPE PuË}fE؉EGt؉Gt ht EhtjXSGUWVSU}ȍt2H ,Z CZ UBRDSVQ蔐UBDGXZUPBHP虬DžMȅtHP JP E1ɋpt G O@G G^\tgPPGPPu'CF@Uċ$? 븃 h4 hEjXSe[^_]à R]V h0ɋP z Gz υtZEȋUẺAA QQWBHPUċEH$H$NMȅtHp Np hdF hd RZUWVSEEUM Eċp$f@%TLXMMċQfBf%EtiuEE]UMf%؉E1BUjhRDQEgu(EċMuPfDf%Eue[^_]ËUMEdEEE9=0oud@dE9ds%d;€, Шu1DG uËU9d-ds ;=tC;]r;]KuM9M9s=1SЋ 0oDA u);t$,t}EG}9Esu1DA t׋d8$UBPMċud)΋Tu9|r9d׉uaD} qB @B EąɉCUBX;E}PdWPQMċ8u؋dv)l;,E@EEta djjPEPE PuMuuĉMM}V0fE@}V0EE ll<Ed)d9ɉ(H]ȋ )r Fr _UuBRDWVQ MADCXZPAHPÅMȅtHP JP Cuvlv\tLPPCPP蚇u-F=lB@-Uċ$? 6ul1Ʌt C K@C uEd9zEtAE E}u jjPWVUfEM؃ EA0؉A0u9d׉llU@\UEA tuu9sE8~t @UE9rM9Mtutxu)Ή| u6ut_EPt@ ;|u9u׉uыE@mlB@]Mċu6$?u uuċx $?@luH9u%E dUEU ]MU jjSQRpuĉËENufPf% ЉEċUfH fE h0MIlP z Gz ˅tEȋUẺAA QQSBHP諣 E}M @jjPWQ誽UM‰uUq0UƉq0uf}UBv }EEUl MċEP$P$ R hTt R R h< EhjHQEċMUB$ɉB$MȅtHp Np hdǿ uhdj^Sq\UWVSEEM UZhf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSM }]Q,BPf@ %PBLf@ %PEPAVQhh]Ɖ)) 9~@RPWP藧ƃƆ FuE Ee[^_] ~'UWVS,MUEI0R,EUMA4R]A 9A$]sVEPSQ@c+]EX@x!U JQPEPRBl$Pe M]ȋy4y4s XCE|߉|WWȋs,VS(ЃXPNU===E}+EH$PUH$Mx],]SCJ@ ȩ!C$EMXPh1ъCfETfCf%LXM܉E؅U؍]Ћ]܋Mf%41AD0Ej h VS能t6Uz$PjhyS Uz$EM؉MԋXfDf%E؅hU1ۋ~.Mqy\ECQVWURU9ۋMY;] ]MRPEPEPn]t(,E04UM]B4@@ǃPPjEPտ^_PEXPStUz$pu Pz$u M1y$e[^_]ËE@4e1[^_]=,t=-M9]]C@J06 jj}WSuV,MUƒ YtUËEЉYtI]fPf% ЉEUfH f jhyVSMQͲ]MЋU܃ {tljUfE{tx$=Ut@DMPTQEpu<uPuFtPPEPEP"UrF]t*C$TFNE8BU%8=8cMy$YFS Щ!t'Ex$C@ M|_02Uz$E@(^x]M )?9r EjPEPSGPU‹G xu˅1҈…tEEG=-z=/! 5gVqgEE=^"MSPRQHr  UO =ZEPQwVRrG]É]O  UE E]uEG}PPWE @LPiMq$pu Pq$u ]s$1e[^_]Ë}G$G${8s8u3?9tm EMjPQSW uׅ%t͋EMǀSSjQ_] ZPsLV1Ur$uuZ;|tj@;v 9ErFr;vEp$p$U MYQCJ ȩ! ]1u {$[fCDžhTfCf%tXplldpdf%<1Bj h WSD8pt6Mq$PjhySpEp$MlhYfDf%lP|1~7u^|GP`PE SPh|9ϋ|\t]-}w$ |ËxHH9uuD?9 |uMjVQRGP‹G xuŅ1҈…t_ UZ@;v 9B@B;vEP,p0BF |BUpB Ct ǂ`Mq$q$|x,U@z;v 9jB@B;vUыr0R,F B|BpA Gt ǁ`}w$w$;|C t 1<u<u}WPtEuVCr t}fff w C BEp$uBP@Z@ ة!t-]{4E K ȋS0Ѐx_0Ep$UB} 7U B(^z]2]uS,BXJ(B B$B B,B0Bt} U w4Bw41ҋtt ^‹M ҉Q8u ] C8`EX}RPE PW9]"&]s$ UZMt MA@x$] } CPEPWSCpPU u} ]FdžG4VVjS7ZYPLWaUBX\_ gPPigE pjjVS] S]pd‹K0pK0[hfWf % ЉffN :}PPQW=U B4v gPhgE jhyWS] S9F+ʋF(NDVHE9ED;M}%tFAF@@FA<vE=(tD819 Xd@]K]MzE؅VF 9v~E)ЃXEFP8UBUBBx눍&D>VU؁9FFXF)ЋU܉E9"PPPPjWlFPF$P$EUBP=(tE d8EPYFTtUJJt돸5 PGFTiExxfG8 }%U!‰Uu U9U}%t!FAF@@FA<vlFAF@ZtNhG8 EPPFTF@FA@F@<v á0t90c@FT܉'USP]S, uY BStwCuS C PߗSC(S@ C]Ãu؋C(S uPPjK QlXZjC PF]UWVS E](t|Lw,tDt^U D(tdEPxG_GC$u SC0C0e[^_]Ít& cE7FTuEF,u>% = 60DQQjURlF F,FTO(At%A Et EEA%"=uFL@t PP )!_s$u S͉K0K0U(tUUdEe[^_]É%"=SF1ۋ ttÉ^6(t9Hۍt&? W>t&__sQTRDPEPQGu CCrt[stVt jd(tDF0uF,u FT?FL8E$&'UWVS u~(F E^, u,%.PPEjPtG u7K,u8STu1%=PPEjPtCe[^_]u˩tċFFPPEjPpsC1ɋt K_tG 1ɋt O놋FMFPPjQp$WuAG 1ɋttIOFFFF  8밸<U&UPPUB(:u# u%tt/PPjB PtËBBQQjB PpBBPPjB PtƍUWVS u^,> FF (tDC,ډJ % = %=C tKC,uCTt%"=V(Bt!B =EttyEEB)^S$u SEC0C0e[^_]ÐCTt#C,u {T4VVPPjF Pp @뀃> VxNN C1tt lj{F (t DF (tdF PxFFC0u{,u KT>UPP A @A t.sB @B$sB0BDB8tFB@tHB4B<WtJ t;By Rނ@1à QSf뱉UWVS =ȸt 1ҍe[^_]Pjjh轰PtHLEt=D_\;E~Et P%?9}Ƌu⋿uË}GS}jMFQh'H>RjVhL@ (oPjjh A&UWVSȸE#Uu<tfEHuEHuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]á@ct:tt2CuPPhh? Phj$;CS PSUSRuHE4U_UE PEP:%Ív'US] tHP JP KtLH IH PP JP []ÍvUSPȸv HPaZuC t S趱9stlC$t- CP蘱sSDHsss tX KX sI s]s눐UWVSUBxHtExtUB`J\Ft&ǁ uE9}}^MMEEtt&A#9tJ uUME䋚)AM9}UB\뮋M[^_]Ãt=1҉ËE;] ШtM ]vMrUP\@d@`@p@lǀtDBt2 u.t*t.Adu Au@AdApu]ËA`@A`Alt&U‹H`t @lJxBt]ËtBxBt]ËBpBtBdBx] UVS]Ss;StMu3SS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉSS빉UWVS}G\LJ \LJ[LJE0%t6Uډ]}Uu6%uʋu_|EEt01ҋFFt[E6ȉEuЋE9E|QSSjMQ9LJ2}e[^_]e[^_]ËE6ȉE룉EUWVS ]SK{9 P()P(CwdNGpwd9tBtt ut቗l kufSSe[^_]Ë;䍇GGlG`HG` Pޫǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPS蚬e[^_])QQPW^jUWVS u^\dž0bdž]dž`cdž$&CCu߉xFlFp^\dždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPWͪt&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFpFd@FFduP؅tt>9ut6.&;aiFlF`@F`O(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AlAp;B= PV UZ(B$؋Z )1dEGGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P8 V!E싗Y[X)ЉVS_vUVSuue[^]Í& S豤XZV )1SPe[^]Í'UVS]SKs9tKu4t uu=SSe[^] uu;u܃tBVp)‹FdHVpFd9u8tBtt utቖVl)‹F`HVlF` P蛣ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFpЉFpFd@FFduT؅ttB9ut:2;v~FlЉFlF`@F`S )1PPPQCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xpωxpS )1QQURP莢ECCe[^_]Ë9]e[^_]a]e[^_]aE)plΉplY P豠sv'UVSu^\džPgdž`fdžphdžedž edž$&CCu߉^\dždždždžt\CtG uCt?tHS )1PPPPue[^]Í붍&U1WVSEUu RtPEPj?V(Ã1MC؉])u)ƋEu E3vWuVj&SO(ÅCM؋U)ȉ])‹EU9EU<=uM9މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1qte[^_]Íe1[^_]Q_ v'U1ɉWVS‹E;@`dEǀMfff EǀSSQRU=LEEE=(t)9~%!?EЋUЋU)ЉENfG/űE@EԋE9,fuStƨ1tPEǀe11{x~#v1Ѓ9v1stыMeEK`Eɋt@uƅC,tAK4t)F @u@1ҩt t@u‰뻃 S9C s99]빋MMK`uSdEEEF$u F(F$F بt@utGF 9w<ЅtwDžuyEkFVFF(EVF$F 맍&Ft&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC PcF @F G,t)G4tE}艇 WA9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EMMUMPEUWPJQMEHxU1WttWXx;Gt| LJ1EE*;uuȉ]9_t%!9ڋC4F,tà V9F$s밉؅ExE1񋃈UpLSdA@S YWRj&Pq EPUSXKt V9F$|]ȅt M̉EWlX ]tQ9}t5U^)ȉPPPSME苀Eu9}tEqU苒Uusv'USP]K$uSfBhtzBLBPBTBXBtBC@uf$fff&fff1K$]ËB t1BB B$B(1K$ƍvRt0yc$(,0뵁 zmfff&ffE SHK$댃 S7K$UVSuuiF$tj1tW9tOF%t KC,C4S<~ 9S4} Ve[^]à VÅtH;t%=taF$8<F$F@Dt~btcpRRSVL1`?ɀtPPPڃ S^9C r䋞04F8<\t&UWVS }G$u WpXG,XPPjjjƃC /94cTd )QhjV@ jhjjV @WBB@B%1E=]G= EPB\PSV\=Å VbK PPGVh|Q[QGRh jP5S `e[^_]ÍvWGJ@!ȩPPVG,@LX SWBtW%1E=S==@EPxPSVX<ÅPjSVw@G, (t@PD D (tO0LFO,DMDL \DF;X~XPPjVhO,APt4_$@_$P$BP$;P(PWt QЃO,W|YP1ҋ t ‰S1ҍe[^_]ÉP(=Et&RRhl(oPP4$"pe[^_]Í& jhj jV t& jhj jV Wwsorfj] btdnq V@w @PPjjV W=E} nPSh(oP|O4$^XSQGRhjP P`BlE: VK SSGQh NGRh jPO yB| @PPjjV E h\ M4$,P V0VVh(oS`Ntet~it  5XVGShPPGPh MGVh  XQGRhQ XPGWh4PPGVhL[QGRh( 'UWVS ]3C$tgSBtaC$ SuC,@Px0u@0@4C(,e[^_]ËSC,@PH0J $(,1҅tC,@Pp0$@0@p4tUXH \H9JAJL;TvTt $C(, V4u FF,t V 9F$ PCs,1ɋx~Ptt[FPO@0p4z})ljHt"BHB랋EBݍUMAtt$9} ]Ë$)Ћ ]Ðt&UWVS EUt uUBh% Bh1e[^_] t*u.UBh% Bh뿍t&UBh% Bh1Eu0UBh% BhEp>iXUD8jj jPUjj jDPU(E: 1lu1Beu1Bnu1BtaUD8(jj jP'Ujj jtV U@,g1Cr1Ci1C UB8U Bh% BhR+XE@P^U E@PV U UB8 UB 8+U$ǂ$0 .sPPj)VE Å9 ШU Bh0% BhWJU)4ZYPV@Uǂ80UB8Eǀ8Eǀ$EDPhl EPE P# E|Wh ܃ P:U$ESh Qh( Ph\ Ph Ph Ph@ UWVS }u]G Vt@ȸ(ttPPF PP tuԍe1[^_]ÉtC`u te[^_]ËCd썶UWVS u}]F Gt@ȸ(ttPPG PPytuԍe1[^_]ÉtS\t Buue[^_]ÍB,tJ8dd1gu1Biu1Bdu 1Bt&dddp LQ@epd:tjd1uu1Biu1Bdu1B jj jpDP^ped:uv h\dS)4c@4ce1[^_]"jj jp@P…)4c=d)dУ4c뎍vjj jpDPjjjp|Wv ep tV@PtjPpAP5u\tto(eVhUREP e[^_]QhRh؋pLQhHVhPh볋p\ShPhHPh둍&'U E hPEP;ÍUWVSEEME耽U@0Ew $d11ۍe[^_]ËESMfǁe[^_]ÅZt|u PE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9`]fǃ uufdžE tFhhXM lRhP(Ehh] dP`P(Ehhu PP(1҉EhhWRP(1҉EhhRP`(1҉EhhRPA(EhhhVP@)1҉EhhRP(ÉhhWPtZ1YRP'}WuVMQUR}W}uVMQSPhh^W90hhVE \RXP'hhU TPPP]'hhM LPHP8'} W t Jt QVSPEhh^Pa8 uPPV1ۋ}W4}E Ux\fǂuE fdžt}fLJR}O]/utt+9xt#U]lj}}uE܅u}܋EEP9 ËH9%E] ]t EEEE?Q}E ttU } S PRrPjE QR`P,eP1U z\PM ˋ$)PPAdPA`PIt{|ʋ׉ƍTP P} DS@Q<R8V4S0Q,V(STQPVLQHSlQhWdV`SQM苀PPPPPPWhh^Q\5İ]VVS]S11ۃu/hhdP`P#EhhX\PXV#Ehhh_,S$EhhG(RPF#EhhWG$RP'#1҉EhhTRP#EHhhQPo^Z1RP"EhhhV_%&]*PPU ЋWV PRdPjM `S,eR A t Ht R] \PXPTPPPLPHP؋lWhVdS]苈`QRPPPPPh4h^S'p jQc$<VRLY[GB3UWVSEu} E耽$1.t&{ t tfdžÉufdžfdž%e[^_]ø u PEhh^P&UB ~ EQhh^P&džpX]ZSGPP EF$puPF$u F$=fdžyUShh^R/&XEZPW"1҅fdž)Y #XEZPW1҅ e[^_]èRRLhPuRMUBPh0.h^Q%MPh h^Q"PhhQ FVhl9t hltpt[^]hl끍&'UWVS ] uC,K(C@A  up t^)Ћ MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QS01uC4CC01^'UWVS u} t F$@F HF uQF8<G_0uG0Ge1[^_]ÅFt04듃࿉F$C$HC$F HF pO0t $F(,tS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@&S4C,t S9C$s PF$F$G0_4C6C,t S9C$ QtCtVGOUWVS } uG,_(EF@unC(^{]Ft }Td tZFV@r!tEQjW RUBL@ PX*C4C(XC4{Wv,dž  E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$)Ћ Mb<))ʍe[^_]Ðt&C,@u kU CSS$SC0 C0 3] ue[^_]Cj)Ћ MbC<))ʍF(, SS$SC,{0uC0 B VvaXH\H]9\A@AL;TTF@CCF$=p{{] ue[^_]LC,@u u F@)ȋ  )ѺMbC<)ʍSS$SC0 $S{0C0@{4tXX H\HM9JAJL;TvTt $F(,tAW4ut0Gt*G,t Ws9G$s W蜾 SS$SC,)Ћ Mb<))ʍbuY)ƉHtHAEAHJMM)Ht!BMBHY뺋EBލt&UMQ$u!AluAX\Q$]ÃtwQ$Q$ރt Q$΁Q$ÐUWVSEp@@0 ^,N0$E FDMF F| VlF N0~ ^,CL8 CP8Q ;E uU1UEptACL8v̀C4  %1ljptE # C4u u CL8 uC0t Td gЉU% = & E%=%`=@%` = `@SP:u"t%=%VlBwf^lt&JFlQQPVVl~u.tϋ@tF%tPPFlPVVlt^,E1ЩptECL8CP8EN0t&E7 uE1؉EEptAALڃ8v΀y4z 0%1ÉptE A4u. u&AL8vA9A,sA, uA0= u;A0t4Td t+0t90c~VFz@ E% = %`=@%` = `@1E1ЩptE^,CL8CP8U9Es@c-AP8 JF@t F$AP8^,CP8x N0F4F8FlFpFDFDF|F|f uCAS{}tUt )~}Qytхt )~EʅtUt )ȅ~ʋMQ4{4t[8҉t хuEʉH4NHt˅t Љ)ȅ~ˋMډY4t˅t Љ)ȅ~ˋEX4Ee[^_]èC4C4C4C4C4,0t90cVFz@ unb UC9C, "C0=K,C)9s)S0C,: -Y,A)9s)Q0A,C ' Vt`Vlf SS$SC,C0uC0@Fl $QQSVЃVl)Ћ MbFlEG))ʋMʺ V%6N0rCP8F@ N0 E@C,e)؅x^lPPSV~l^, P+q^,t PqTVy[N09PPSVGt^,aPPSV? ^,PPSV3Bt^,7PPSVtЋ^,)E@ APPPN0Y4 @V$pU0V$VXN00*PPQVQ<N0 ALPPN0F$pA4N$@N$VpXN0^,V@qWWSV^,VlB ^lS$$膫F04t(,^,C4F0@4F$pu@F$f F$Yt ALPPN0Ad APPPRV$p V$VXX^,C42@( CPPP^,Ѐ@ CLPP^,F$p5C4#N$ N$VX^,(V$0V$D F$@t ࿉F$Z$KZ$QQjVFtAS4ut0Ct*{,t Sѯ9C$s Q^,$ B -F4 ^4SVL$VP$\^,C4F0@4tF$pu F$[ F$N&F$ F$t CLPP^,C5 CPPP#t~l ~4 YN0^,CPHFIF$tFJH@cr)Ћ Mb))ʍډVlX|t+F$ u%F@tF,PH@D t V V]Ex t! P%U9su sMq$t4 ȃP%MsKsQDssMtMP JP sHs1v F4PFl$^,¯uC t )ȅz/uC t )ȅhuC8 t )ȅSN0¯uA=t )?/uA=t )A8=)uht(dt)V$V$F$F$/t @7pF$@F$0atWWCPf@ %PF,@Lf@ %PFSQh4h诰Phj߫+|~8PPfFx%PfF@%PFPWh4h,Phj\O~p;PPfFx%PfF@%PFPPh4hԯPhjPPSV7F$0t&US E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVSXP2C8]Ít&U]ÍU $t |)A $tǀB4B8B, B$B(B pB`BB B@B@BB]ÐU hjh{ hjhg$軣Í'USP]w ݤu%PSh5 (oQXZjST]Ívݠu=)@BݠPPhS]QShL5(oRݠŐUPPEU =w.ŠtOw2ŤU E鯣vhPh|5(oPÉŤE E}벍UWVSh1Whj[ 9}5t@u,ǃF9|PjWje[^_]à RЃ ÐUEP P ]Ív'UEEtP P 1]Í&H H ]UEH H ]Ív'U]ÍU]ÍU1]É'USP1M ]Q$;St ]ÍA(u PRCPYSu ]PRCPAP觥t1]Í'UVSuF uCVF jjjE NQPR: VFɈe[^]PPF@Pj1ɉÅtPFPFPSVF u^F v FP赤F V؍&'USP1M ]Q$;SA(uPRSRAPt1]PRCPAP腤u]Ð&UVS1ۋEu PN$9)F(u3X)SQRFP茢t1ۉe[^]Í&XP)QRvV ˍt&'UWVS E ]H$S19ZC<U )B(tT9 oMrC9wmM9uPE @$PSV蓣uԸe[^_]Ív9w0U rC9w!8uPM A$PSV袡tC9vߍe1[^_]UWVSNJEZ$Eۋr~;8/?t}~L:M/?O19|HGR(E UM})߉};}wE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$8E @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP%Ðt&U$nEP n$n]ÉUEPQP@ ]ÍUWVS u }PPWCPt9ue1[^_]Íe[^_]UWVSj(EP蘕tu= n ntSu)E_t:QUsREPCPu CU<tCu΋? nue1[^_]Íe[^_]à EP蠗}r&USRË@tS u CP S]à P҃C P؍t&UWVS ǍX@09uG __uGHIHe[^_]à P袘GHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjj1EtU؉PJEAJMA AAAWWj(StV@EQQj)P謓RRNjE)ǍGPj轗ÅPWEPS贖E܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjj]t) EEj Sh ,jPԃ 1@tЋ]]81҈ƒUUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVS,EXEE9E =UM܉}؉EԋUEM܋UEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Emsu=1ۋ=PESPWY^PES1U;u%t1t&|u FU;u%uӍe[^_]ËEH E؃t؋(t|t؉ڃ tڋ (t| rD` FST Pu E f1)ЅM )CM  SVt&UVS4cuP j=t\PPSj't5PPSjt e[^]à P P1F8Ѝe[^]Í&US]P跁XP諁YR螁C8]U]ÍU $t |)A $tǀB4B8B,B$B(pB pB`BB B@B@BB]ÐUSQ̀Ãv }ۉZ[]É'UMʃɋU B]!Í&'UWVSEE9E 5UuU1ۋuǃuɋ9tR0n=($tɃ $̀Ãv|ۉ5u]EC]9E`[^_]Ít&'UV5 SӋu%@ ؉[^]ÐUWVSSE] ƉEC<1uE ى Z[^_]Ít&'UWVSPE] ƉEC<1t!E't: wUU- PjgEEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ\i9sUډ@C9r18}t MQ(iF w$; p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1EEtq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸEL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿEL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$G~1ۊY!#E9t]υt=pT1A1ҊQ 9At1t1pT%뎉[^_]ÍvUWVS1]1O~PP$ IE PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1pT%`FW1C1ҊS ƃ>FC4M!1̓w3$PJ1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊTpTL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ TpTT$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$pJS!1C!̓w$pK1BR Ѕ~1(jjj1pTPÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸D=Nju =D=t3%9u<VPEP_ uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$KEU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0RT=}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$M1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCS|OT`MMT~`U(RjjTQtWTVP-O`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`QP` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`QvO` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP1ME`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$MEPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71BE%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}E@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSPI u @CRQ VJD;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPWI t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM11E1ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$dNE%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEZMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $TOjE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$PH@vP@t<)u担87DžRt#EH@%u㋅8) PB<v?t { 5EB1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WoЉƃ؅uDžM ERCP~NF fF(ffVffNfF}ZtSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:V oЋU+M MHn}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$R]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB Pe'C MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh oU ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PoЉEupEEMP EPRQ%UM$ ABLErLPjURMQEPURCPV u'EMA`Up9R o]Ex`UH EPRQ@%1C1ҊS à ;AoEUB`Up9&R oM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ|![] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE RRDž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžZE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPoЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Usage : %s -f [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon ; implies -q -q quiet mode : don't display messages -c check mode : only check config file and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Configuration file is valid : %s Error reading configuration file : %s No polling mechanism available. [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselect%d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEFInvalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789: 'D S@gt  ɬӬ۬@@ splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerpersistredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledenabledhealthbind-processevenappsessioncaptureretriesblockunlessredirectlocationheadercaphdrprefixuse_backend(unknown)optionhttplogclear-cookiecodetcploghttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForEHLOHELO%s %s HELO localhost HTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 default_backendredisphttp-checkmonitorfaildisable-on-404backlogfullconngracebalanceserverredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttracksourceusesrcclientclientipcliexpreqrepreqdelreqdenyintefacereqpassrewritereqallowdrop-queryrealmreqtarpitindirectinsertreqsetbereqisetbereqirepreqidelreqidenyreqipassscopereqiallownocacheenablehide-versionpostonlyreqitarpitdomainreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionhdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionParsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. Maybe you want 'maxconn' instead ?parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects [:], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : weight of server %s is not within 1 and 256 (%d). parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: custom id has to be > 1000parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s' expects 'code', 'prefix' or 'location' (was '%s'). parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. Maybe you want 'fullconn' instead ?parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots or does not start with a dot. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. parsing %s : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. parsing [%s:%d]: negation currently supported only for options. Proxy '%s': loop detected for use_backend: '%s'. parsing [%s:%d] : %s '%s' : fullconn is mandatory when minconn is set on a server. parsing %s : %s '%s' cannot use both transparent and balance mode. parsing %s : HTTP proxy %s has a cookie but no server list ! parsing %s : '%s' will be ignored for %s '%s' (requires 'option httpchk'). parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing %s : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. parsing %s : no line. Nothing to do ! parsing %s : %s '%s' cannot be in health mode as it has no frontend capability. parsing %s : servers will be ignored for %s '%s'. Errors found in configuration file, aborting. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. parsing %s : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': unable to find required use_backend: '%s'. parsing [%s:%d] : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': unable to find required setbe: '%s'. parsing %s, %s '%s', server '%s': unable to use %s/%s fortracing: disable-on-404 option inconsistency. parsing %s, %s '%s', server '%s': unable to find required proxy '%s' for tracking. parsing %s, %s '%s', server '%s': unable to use %s/%s for tracing as it does not have checks enabled. parsing %s, %s '%s', server '%s': unable to find required server '%s' for tracking. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled againCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPHTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)timeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! parsing %s : cookie will be ignored for %s '%s' (needs 'mode http'). parsing %s : server regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : client regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : monitor-uri will be ignored for %s '%s' (needs 'mode http'). parsing %s : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket. Aborting. Invalid name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket. Aborting. error when trying to preserve previous UNIX socket. Aborting. cannot change UNIX socket ownership. Aborting. socket(): not enough free sockets for UNIX listener. Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener. Aborting. cannot listen to socket for UNIX listener. Aborting. cannot switch final and temporary sockets for UNIX listener. Aborting. cannot bind socket for UNIX listener. Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE`HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. iIss @nr .....*0gSv's  /HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession:calloc(). Not enough memory process_cli():asession_temp->sessid:calloc(). Not enough Memory process_cli():asession_temp->sessid:calloc(). Found Application Session without matching server. Not enough memory process_cli():asession:calloc(). Not enough memory process_cli():asession->sessid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valpathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/; domain=%sCache-control: privatesrvrepsrvhdrConnection: close: %d.%d.%d.%d HTTP/1.0 clireqclihdr: %s /ExpectContent-Length100-continueappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for server %s/%s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. Cannot bind to source address before connect() for server %s/%s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓NOLBno checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,OPENFULLSTOPactiveY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,%s

 text/plaintext/htmlunlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max, Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,%lld%lld%sBackend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%sDOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy version 1.3.18, released 2009/05/10

HAProxy%s

Statistics Report for pid %d

> General process information

%s
QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits : memmax = %s%s ; ulimit-n = %d
maxsock = %d ; maxconn = %d ; maxpipes = %d
current conns = %d ; current pipes = %d/%d
Running tasks : %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.18 Release_date: 2009/05/10 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: s4B!}%Ч ī߫zreq_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentreject (unexpected character '%c')response-onlylayer 7cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparent'%s %s' expects a positive delay in milliseconds, in %s '%s'acl '%s' involves some %s criteria which will be ignored.ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sectionserror detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_end55555ư55Gů5G55@6 6@666@66@#6+6@0656@:6@6M6X6cg6_u6w666ǯ616ǯ66ccccccc!=====S3BiDumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splice@9O9R9U9X9      ;;;;{;m;_;@;$;;::::::::match failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6d1.1.8.*.8.*.8.1.1.1.#.:;<=>?@[\]^_` >=8=2=,=&= ======<<<xdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error /.........]0]0]0]0]0]0]0]0]0]0]0]0]0]0]0]0]0]0.]0.]0]0]0]0]0]0.]0]0]0]0]0]0]0]0]0]0]0]0]030]0]0]0]0]0]0]0]0.]0]0]0]0]0]0]0]0.]0]0K/ 2 2"2"2"2"2"2"2"2"2"2"2"2"2"21"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"2"22"2"2"2"2"2111"2"2"22"2"22222223333333 333[32222222[3[3[3[3[3[3[3[3[32[3[3[3[3[3[3[3[3[3[3[3[3[3[3[3[3[32[3[3[3[3[3[3[3[333[3[3[32222222222^2^22[3[32^2[3[3U3U3[3[3)3)34444444444444444444444444444444444444444444444444444444444444444444444449PQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQk9PQPQPQG9>@N@PQPQ9PQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ^@PQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ9LPPQ49PQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ@9<<u=W=5==,IHM,HHMHMHMHMcHHMHMHMHMHMHMHM]L]L]L]L]L]L]L]L]L]LTHHM;IIrIHMHMHMHMIHMHMHMHMHMHMHMHMHMHMHMHM>JHMZLVVWWWVVWWWWVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVWWWWVVWWWWVZzezeze_dZZzezeZzezezezezezezezezezezezezezezezeZzezezezezezezezezezezezezezezezezezezezezezezezezezeze[YzeZzezezezezezezezezezezezezezezezezezezezezezezezezezezezeZ[_bA_bbbbIabbbbbbb___________b a__bbbb`bbbbbbbbbbbbL`b_bbbb}bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbtbbblbbbbbbbbbbbbbbbbbLbbbbTbbbbbb\bbbbbdb.muuvvBwhwwwwwv.w:::vvmuv}'}}}}}}}}}_}^^^^^^((V::::::::zz: xonrsssm\nm\nn@qkt sYstuk…B>zLJ؇ t܉D#!!ZZZZZZZZZZZ}ZtZqZnZgZ `Z ]ZUZ LZ DZ 9Z0Z'ZZZZZYYYYYYYYYYYYYY Y!Y"Y#YYYYY YuY$rY oY lY bY%ZY&XYUY IY'FYCY=Y(2Y)&Y* Y+Y,YYY Y YYYYX-XXX.X/XXXX0X1X2X3X4X5X6X7X8X9X:~X;{X<yXvXsXpXZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;45T6(zR| (04 (H$5 ` `pC 0`'$  th W a|8o<ool`’Ғ"2BRbr“ғ"2BRbr”Ҕ"2BRbr•ҕ"2BRbr–Җ"2BRbr—җ"2BR` (e'`e`e¦ƦʦЦ֦ۦߦ$).48<ЦBHOV]dkry@PfPf0@ưP@@0@ 0"*5@unix_streamnlFM pgg`@;<`<G< =pO<=pX0=_pP>pcpP>kpP>spP>p{pP>pP>P>>@0?p@@p@@p@@p@@p@@pp@@p@@00A0pBp@p@p@p@p@pp@p@0A0BpCpCpCpCpCppC"pCt4 pS0Y0c0`p0Pv            101p1ptcpv6  FMPp@m@mtcpv4FMPpmm5@`5@ `6@` n n(n(nEEE`E EEDD@DDCCC@C%CCBBBBjBUB?B!BBAA`A&AA@@`@Q@ @@???g?@??>>>`>%>><<Qed`(d`(P<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&@n-ic9-$-c$C0)DD$ c$J<)cIDK$"c$R`)cQDS$"d$p)doDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$)DDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$,*DDD!D(D7$;d$h*DD $d$*dd DD DDDD+D/d@d@d@/$/e$*dd #eDDDDDDD*D1d@d@.e@d@1$19e d*libtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)4A8 9s)H`#M09 ~pKaPFvP,+`*tz0{Ky`G@rzuqCmDULpY2P,@ Ḿ`\H  M) ^.0 7?`SPjA āPp34*display_version*display_build_opts*usage*sig_soft_stop*sig_pause+sig_listenF+sig_dump_state+dump+init-deinit0run_poll_loop*1mainO3globala3prognames3pid3relative_pid3trash3zero3one3nolinger3stopping4cfg_cfgfile4UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)A8%a2base64base64tab8 9 ! enable_listenerF disable_listenerk enable_all_listeners disable_all_listeners unbind_listener unbind_all_listeners6 delete_listenerl protocol_register protocol_unregister protocol_bind_allprotocol_unbind_all7protocol_enable_allmprotocol_disable_all)Hstats_check_init_uri_auth&stats_set_uristats_set_realmstats_set_refresh>stats_set_flagstats_add_authHstats_add_scopeC#M}1$ultoa_r%strlcpy2P%ulltoh_r%limit_r&str2sunb&ishex&invalid_char&invalid_domainchar&str2sa[(str2net*str2uic*url2saW,encode_string,str2uiP-strl2ui-strl2uic.strl2ic.strl2ircD/strl2llrc/parse_time_err\0my_strndupB1itoa_strd1hextab~ `init_buffervbuffer_write2buffer_write_chunkbuffer_replace buffer_replace2r buffer_insert_line2 chunk_printf, buffer_dump pool2_buffer,c&Alert&WarningL'qfprintf'get_log_level'get_log_facility=(send_logq*tcp_sess_log3,log_facilitiesU,log_levelsw,monthname,sess_term_cond,sess_fin_statea*#__task_queuey$__task_wakeup$wake_expired_tasks]'process_runnable_tasks(init_task3*nb_tasksE*run_queueW*run_queue_curi*nb_tasks_cur{*niced_tasks*pool2_task*last_timerNFu_tv_ms_cmp_tv_ms_add>_tv_ms_cmp2_tv_ms_le20_tv_ms_remain _tv_ms_remain2 _tv_ms_elapsed _tv_addp _tv_add_ifset _tv_remain _tv_remain2 _tv_isle _tv_isgtk tv_update_datehuman_time]curr_sec_msocurr_sec_ms_scalednow_msnowdatestart_date fd_deletedisable_pollerinit_pollersIdeinit_pollersulist_pollersfork_poller cur_poller( nbpollersJ pollers\ fdtabt maxfd totalconn actconnrS > get_pipe kill_pipe put_pipe pool2_pipe pipes_live. pipes_used@ pipes_freeR,x&/$exp_replace %check_replace_stringB%chain_regex&pmatch+g$.warnifnotcap.warnif_rule_after_block//warnif_rule_after_reqxxx/warnif_rule_after_reqadd/warnif_rule_after_redirect70warnif_rule_after_use_backend0warnif_misplaced_block0warnif_misplaced_reqxxx;1warnif_misplaced_reqadd1cfg_parse_global8cfg_parse_listen`readcfgfileecfg_register_keywordsEecfg_unregister_keywordshttp_process_request_body0@check_response_for_cacheability@produce_contentzAapply_filter_to_req_headersrBapply_filter_to_req_line?Capply_filters_to_requestCmanage_server_side_cookiesEget_srv_from_appsessionFmanage_client_side_cookiescIapply_filter_to_resp_headersZJapply_filter_to_sts_line'Kapply_filters_to_responseKdebug_hdr Lprocess_response3Ohttp_process_requestapool2_capture]apool2_requriahttp_is_ctlahttp_is_sepahttp_is_lwsahttp_is_sphtahttp_is_crlfahttp_is_tokenbhttp_is_ver_tokenbHTTP_200bhttp_200_chunkbHTTP_301bHTTP_302bHTTP_303bHTTP_401_fmtchttp_err_codes8chttp_err_chunksZchdr_encode_maplcurl_encode_mapchttp_methodsdsess_cookiedsess_set_cookie.,'splice(stream_sock_shutr@(stream_sock_read*stream_sock_shutw*stream_sock_write+stream_sock_data_finish,stream_sock_chk_rcv*-stream_sock_chk_sndD+%appsession_task_init&appsession_initW'appsession_refreshS(match_str(destroy(appsession_cleanup*pool2_appsess*apools*have_appsessionILpK=+recalc_server_map-init_server_map/fwrr_init_server_groups 6fwlc_init_server_treew6get_server_ph6get_server_ph_post8get_server_hh8assign_server@assign_server_address?Aassign_server_and_queueAconnect_serverCsrv_redispatch_connect@Dbe_downtimejDbackend_parse_balancew'#stream_int_check_timeoutsU$stream_int_report_errory$stream_int_return$stream_int_retnclose4;,print_csv_headery,stats_dump_proxy-stats_dump_http.stats_dump_rawd/stats_dump_raw_to_buffer/stats_dump_sess_to_buffer0stats_dump_errors_to_buffer 6+tcpv4_bind_socket@-tcp_bind_listener6.tcpv4_add_listener].tcpv6_add_listener.tcp_inspect_request%M14&&sess_change_server[&session_freeo'init_session'session_process_counters'sess_update_st_con_tcpn(sess_update_st_cer)sess_establish)sess_update_stream_int+sess_set_term_flags+process_session2default_srv_error3pool2_session3sessionśAhdr_idx_add$&a$signal_init$signal_handler$signal_register$__signal_process_queue%signal_queue_len%signal_state%signal_queue&blocked_sig`0<l*acl_parse_nothing*acl_fetch_nothing+acl_match_nothingW+acl_match_str+acl_match_reg+acl_match_beg>,acl_match_end,acl_match_sub-acl_match_dir-acl_match_dom1.acl_match_intl.acl_match_ip.acl_parse_str2/acl_parse_reg/acl_parse_int1acl_parse_dotted_verr3acl_parse_ip3acl_register_keywords3acl_unregister_keywords 4find_acl_by_name4find_acl_kw5parse_acl_exprk6prune_acl6parse_aclP7find_acl_default8prune_acl_condy8parse_acl_cond9acl_exec_cond:cond_find_require;filt_cap<default_acl_listrH9&#create_pool`$pool_gc2$pool_refill_alloc$pool_flush25%pool_destroy2o%dump_poolsI read_freq_ctrAfreq_ctr_remainnext_event_delay.M)feb_deleteeb_insert_dupc.[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)7check_cttproxy_versionāOO__udivdi3`O__umoddi34{ G0A@  "0 #[<7< &tB 5into 60 >EG ?E) AE3 C Di GPAIF S U  0) #-<% #-=$#/$ #$ #6 $ #  $#$#O$# $#z$# $#$$#($#,=$#0$$#4.$#8$#<w$#@o$">#D $#{#F$$*#Gb$(:#H{$1#L$7/#T;$8/#X[$:#\ !$<@#` / d$k $ T$# $$# 2 $#< :  P 3IB+GQHFj  D h E# f F# $/ >f   # #  + ) # ! #  +# ; wgC 6 7#A 8#2>q40Yg7 rY  p# ڰ# }# X ܓ# # 7 "kC"t "v# o "x#hI n h#p h#C  - C#ref !h#074w x# IyC# `z0# x {0# b&|0# r}0# [ ~0# =0# -0#$ u0#( @ c bc# ss @ ]H#s#s# bit#u32"0Z* _+y#key,#r H0wq1#rq2# v 3#0 4#4 50#8 6#< 7/#@ 8#Dr  N# # # [# C# N# #n(8'H v 'I0#  'J0# R'K/#fd'L# ='M0#exp'N0# 3'O# 4'P# w3'Q# $4'R#$ib'SJ #(ob'SJ #, b 'T0#0 'U/#4J 'S =}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 W 0#4 #8 "(3 #< 7#@ 7#A b#D J#L a #P ? #T E #X y .tstru#lenv#  J  3 Z z I(C# L(C# (# $ (#fe(#be(# (# =(#$ . (0#(req(J #,rep(J #0si(!#4 (# #(# (#srv(# 3(# A (# . ("#txn()# r (# (, # ("# 0(*"#  (‚# (Â# (!# {(0#y 9 V ] +n k  # ! # k auid^f#gid_P# \`[# buxa  $ LfdM# v N# +O# A=P# Q# lR# #S# T0# UU# VC# (W# ?X# %Y# #Z/# W [0# b # u(c# TQ um# n# -o# p# q# r# s#$ Q3t#( h4u#, v#0 cw#4 >x#8 y#< ?zC#@ <{#H I|C#L    8&Cf&A#b&BJ # &?cb&C# R&D/# v &E7#ev&F7# &G # &H#  <&] #&^/# >&_#set&`#clr&a# q?&b# >&c#rem&d#clo&e# f3&f# 7&g#$ r@&h#( $&i#, E&j#0 u&k#4 &l#8 0 a ^/# _%# B`%#a?+ U,# -# .# /# ; 0 { h# # +8len+90#cr+:0#U+;0#b% +Cv+Db# [ +E# `+F# (+G# 2+H# *a    . *h*l*ݔ#m_l*ޔ#u*ߔ#u_l*ߔ# v*#v_l*#f*l*#v_l*#c*#c_l*# r*#r_l*#*rq*st*)D* : *0#sol*#eol*#som*0# col*0#sov*0#eoh*0#cap*#sl*f# | *b#8 *#@* 1*# %*# *P #req*#rsp*#\uri*# *# *# nG*# =*0#ZD  0# V 0# 0#*>|H UI# v J#  K# vL# M# N#  O# &Q# R# S#$ S#( #T0#, 6T0#0 dU#4  U#8 V#< KWC#@ X#H A=Z#L 3[#\ {=]#l o_#| o`# @b# b# c# _ d# Ne# f# g# ;g# "h# h# h# i# j# Fk#idm# n0# L n0# o0# p0# Oq0# r0# Vr0# gs# v t# hu# wt# wt# Zx0# yq# {t# {t# |t# |t# }t# ~# 0# t# ~ t# t# %t# ,#&hDQ p# # )# v # +# I# \# # )$#,aclC#0 ]C#8 C#@ C#H <G$#Psrv#\ 9 #` ) #d R $#h U# J # Ĕ# c# Ɣ# 0# Ȕ# ɔ# K# ˔# & ̔# # Δ# ϔ# yБ# 1 # RҔ# Ӕ# S,&# # ֔# ZC# %%#id# KC# d#  # d# 0# w0# \0# 0# # 0# # 0# t# Xt# ~ t# #0# }0# 70# # N# # h# # ` # (# # 0# Z0# q# t# t# t# t# t# t# t#t#%t##cap#3#{=#o #o #U #A  ##I  ##J {# {#J#R## # #q#p##D #n##1#N'#4N'###]#{T'#} T'##a ##d'#  #w!#"0# #0#$##$##HH, % ) I) C# )! #srv)"#  D( (# z(|# (|# (|# (# s(# (#$ $([#( Q ([#, (([#0 (t#4 %(t#<T!(px(#sv(ǵ# (Ȃ# (Ȃ# =(0# iid(ʔ# G(ʔ#sid(ʔ#k! ( (n#!(iid(Д#px(#buf(0#sid(0# ptr(Ԕ#bol(Ք#!( >'( (T! (k! " " "*" "G!"acl!*I!+C#u!,#cA!-C#  !.#!/0#7""{A!>I!?C#;!@C#pol!A#!B0#,!C##p7 A=4un5V in60#p2u7"##L ,z {H#t0|H#t1|H# 7}# U~# # #$ #()$ |#len0#pos0# sid0#srv#oe#src#bufE #G$be ul$  0# <C#$ srv$# # v #$Xact0##bck0##,$actH#bckH#% # % # # # # # # #mapl$# $#, F$# > %# 6%# u7%# %# %#%%i&  ٔ# 1ڔ# Q7۔# 9ܔ# *>ݔ# ޔ# 3ߔ# #&S,  &# '# Y(# 4)# =*# -+(# ,(# U-&#i&N'  UN'# u# Z#len # !# C"#& d' t'P "'-#6+#u,''I(C#B)'#be-t'# "k(O(0I1C#B2'#G3# 4#%5#6#=70#8# 9#$(  U(# # #k((  U(# # 7#(&),R ,N# ,O# +,P# ,Q# * ,;uid,<#gid,=# ,># #,?# ,@# ,A# ,B# 8,C# \,D# ?,E#$ ,F#( ,G#, ',H#0 J,I#4 ,I#8 J,J#< R,J#@ ,K#D ,K#H A ,L##L I ,L## ,R(# ,S # c,T#$.U$k0BU%* PU&u%* U'sig%+U'sig(F+eəU)sig(+ ЙU)sig*pV+*sS(+=U)sig<(F-7УU,~W,V*iQ-Xp-l.tmp-#h/E,-8S/y,P*cur3P-v 4V-4S0,F-w1Y-2f-w1y-1-1-0,F-1Y-2f-1y-1-1-0-F-*01Y-2f-*01y-1-1-2F-IO1Y-2f-IO1y-1-1-3f-n4m3- -4+4O+4,(/!У6U*pW*p0P*hN'S-BN'V*sV-Sp*lP-S-B'S- 'V*expS-P*acl"S-r"V-$/S- /V*rdr/S-/V*uap&V*ua&l-H!(S*iS/.p5jh/ /5jh/"/5jh/8/5jh/N/5jh0//Ǩ1020Ǩ1+0250Ǩ1F02P06]0P0/o0Ǩ6|0Q20"T1020-T102P0-91]0''70"8t7508t7P08t9i0]:|\i0908tǂ70 ~8t}70 v8tu;0o [@uU)sigZV*p\S<"1 iU-Ujt="1>??2&U,~, *errV-WS-b&`-'2\/1*w|h/1*pxYS*retZP- [V/2(*retP+H--P1@2#2@ #2@&#2@U%LO2U2 @%MO2@@@  @ &o@&t28@&u@ &v@ ,[ 2A @-Q2B&<@z.;@.<@/;0Cnow/<|@/>|@D %Dr&) cD mHSC%sC% EJвFUIpZ IHW idxK0PLHSR%sR%&4jS[PUZW i\0V]HShjg# ݴ  ݴUinQ5<VoutSintI @A @  S A@ "%<7<&^Binto6%>:G?:)A:3CDSAI %) -% -= s#/ # #6 #  # #O # #z #  #$ #( #,= #0 #4. s#8 s#<w #@o "3#D #e#F $#Gb (#H{ 1#L 7#T; 8#X[ :s#\ ! <#` d k T #  # 2 s#    3-In-#p-#I B+ G Q$/3f  _# #   )_# !z# #  w    b  #  m  ] # # # bit s#u32"%Z* _+##key,m# H0wq1x#rq2x# v 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,n(8H v I%#  J%# RK#fdLs# =M%#expN%# 3O# 4P# w3Q# $4R#$ibSg#(obSg#, b T%#0 U#48g S =}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 W %#4 s#8 "(#< ,#@ ,#A L#D J#L a #P #T #X~~gZ m ] auid^I#gid_3# \`># buxa$ LfdMs# v Ns# +Os# A=P# Q # lRs# #Ss# T%# UU # V# (W # ?X2# %Y # #Z# W [%# b# u(c# TQ um # ns# -os# ps# q_# rT# ss#$ Q3t #( h4u #, v/ #0 cw/ #4 >x/ #8 y/ #< ?z#@ <{s#H I|#L ss s  / s  V  Cf A #b Bg#  ?cb C # R D# v E,#ev F,# G #  HT# 5 j < ] # ^# > _ #set ` #clr a # q? b # > c #rem d #clo e # f3 f # 7 g #$ r@ h #( $ i #, E j #0 u k#4  ls#8 s s s      s   s     F )U$  Sk I/0cU$ . S >spU = P$ ? S LsU K P$ M S )ZsEU$ Y S6 njsPU i P$ k Sl xͶU$ w Q !j|- жU  P U  R"!j-s cU  S#errsV7ZspU  S#errsVm5sU  S#errsVsSU  S#errsV$2 $ $ o $ tV $ us % $Q`e^+` G0Aint@ <7BAI U#>#}# U#>#7}#S, %&>#'}#Y(}#4)># =*>#-+#,#U-# `>U   V uS =7 C4߸ 2-  %%b%}P" *%b*}PK@@U  ? uri?}S uASYB}V C> CS =Q\ U  [  ^[} u]Sk^}V l =j>u2U  t  vt>P uvR.@gU    8>P uRBpaU    )} uW3}V $> >-SBp Ѻ ź =P % s%p+U    }V uW}V S(pout! =   % s%y1Ji0 G"0A B@ "0<7<&tBR2B5into60>PG?P)AP3CDiAIFS U 02Iq40Y17 <xY pR# "7 $PI B+ G QHFj $Dh$E#f$F# 7  J| G#  ? J$$/I_f +#_# o )+#!##  w+#G#X ]## B d rL s# t # u#y v#  w #6+nk  +#!#  k ) -L% - =# / #  # 6  # # # O# # z# #$ #( #, =#0 #4 .#8 #< w#@ o"I#D #{#F $#G b(#H {1#L 7/#T ;8/#X [:#\ !<#`/dk T##2 #Y  R  3 b#  E  ]# # # bit#u32"0yZ*_+#key,E#In#p#y - y#ref!#H H0wq1P#rq2P#v 3#04#450#86^#< 7/#@8#DXXXH74#w #xL#I#yy#`#z0# x #{0#b&#|0#r#}0#[ #~0#=#0# -#0#$u##(  n(8Hv I0# J0#RK/#fdL# =M0#expN0#3O#4P#w3Q# $4R#$ibS< #(obS< #,b T0#0U/#4 < S=}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0W 0#4#8"(% #< B#@B#Ab#DJ#La #P1 #T7 #Xk .tstru#lenv#| | <  % Z zIy#Ly# X#$ #fe#be## =#$. 0#(req< #,rep< #0si #4 o##o##srv#3#A #.  !#txn1#r #4#!#02!# #Í# #{0#k + H ] { auid^#gid_#\`# buxaH  $ LfdM#v N#+O#A=Po#  Q#lR##S#T0#UU#Vy#(W#?X^#%Y##Z/#W [0#b{ #u(c# TQum#n#-o#p# q+# r # s#$Q3t#(h4u#,v#0cw#4>x#8y#<?zy#@<{#HI|y#L     CfA#bB< #P ?cbCP#RD/#v EB#evFB# Gd#H # ` p7A=46un5jin6p2u7`# N###[# y#d 8 !a!^/#!_%#B!`%#!a? +U ,# -# .# /# C 8{ ## '8len'90#cr':0#U';0#j% 'Cv'Dj#[ 'E#`'F#('G#2'H# &   a        . &p &l&ݟ#m_l&ޟ#u&ߟ#u_l&ߟ# v&#v_l&# n&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st&1D&: &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap& #sl&n# | &b#8&#@&1&#%&# &B #req&#rsp&#\uri&# &#&#nG&#=&0#ZD 0#V 0#0#*>|HUI#v J# K#vL# M# N# O#&Q#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KWy#@ XX#HA=Z#L3[#\{=]#lo_#|o`#@b#b#c#_ d#Ne#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsP#v t#hu#wt#wt#Zx0# y#{t#{t#|t#|t#}t#~# 0#t#~ t#t#%t#,#&hDQp# ]#)]#v # +#I#\##8"#,acly#0]y#8y#@y#H<V"#Psrv#\9 #`) #dR "#hU#J #ğ#c#Ɵ#0#ȟ#ɟ#K# ˟#& ̟##Ο#ϟ#yЙ#1 #Rҟ#ӟ#S,~$##֟#Zy#%##id#Ky#d# #d#0#w0#\0#0# #0## 0#t#Xt#~ t##0#}0#70#]#N]#]#h]##` #(##0#Z0# #t#t#t#t#t#t#  t# t# %t# #cap# 3# {=# o # o # U # A  # I  # J {#  {# J# R# # # # q# p# # D # n# # 1# $# 4$# # # ]# {$# } $# # a # # $#   # w!# "0# #0# $!# $!#H4% %I% y#%!| #srv%"# D #z# # ##s#  #$$[#(Q [#,([#0t#4%t#< \ px#svǽ#ȍ#ȍ# =0# iidʟ#Gʟ#sidʟ# s ͤ# iidП#px#buf0#sid0# ptrԟ#bol՟# >'\ s !  !| !2!| !!G!L ,z{#t0|#t1|#7}#U~## #$#(8"#len0#pos0# sid0#srv#oe#srco#buf7 #V"beu {" 0#<y# " srv"# #v # "Xact?!#bck?!#, "act#bck# ##% # ## ## # #map{"# "#,F"#> ##6##u7## ###### x$ ٟ#1ڟ#Q7۟#9ܟ# *>ݟ# ޟ#3ߟ# #S,x$ $ $ $B !%<0U"n;[Q# ; #[ ;$pos=S!P%[,U"dst+R"src+S#[ +Q%e-V!%\P׽U"nObVW# O#[ O%)QS%Rp!&5rU"nq[Q# qS#[ qR"altqP!\&?{\&vU"strzS$su|j`o%}P&''__s/j!&!U"sR!&U#uQ!&=QU#uQ!''`XU"strS$sa϶o$cP%TџV(G)''__s/t'0IB'__u''__cӂ*''ʿ+(,(ʿ+0(+<(+H(-'$__vIP&(X$heU(PJ'.(n/m.U( -/+/O+ /,! *`U"str#A= * # *0,0q*#$cV$sW%S$len[P)D)1__s/2+)303I3B1__u*1__c))1__s/2)303I3B1__u*1__c))4errd,(+0(5<(P+H(-)'E4heU(P&m{1__v0](Y)6o*0U7s,o*5*R89*S9*Q:*0;sף'i0'j06+_U7url^<^ ,8X9%,V&92,P&qu1__vI?A,j4/A=3@dst3 *A5A51ch51tmp6A,1tp6Q,1cp7BA>BB1newB Q,x x6,!U<)Q<  .:.P0;s;len'i0'j0'k06.-6U7sS7lenQ4iV4jR1k6D/'@U7sV7lenS7retP4iQ4jR6/!XU7s 7len  7ret /P4i"tVW4j#lt6V0J`U< IS7retIV0PH#( H#, H#0 W H#4 #8 "(#< O#@ O#A d#D J#L a #P #T #Xt.tstru#lenv#EZ t 6] Cf A#b BE#J ?cb CJ# R D# v EO#ev FO# GZ#  H# Z \pU|&vUbuf%ESmsg%r len%Vmax'  0 buf E'buf'- EjUbufDES .DVmaxF K mkpFUbjESposj endjWstrjr!lVlenmr P"UbESpos endVstrrlen!W 0UbESposWstrrlen!V,  nUchkV [ Sfmtr"#h=$retP%u pUou pbEW Stol&2u & u & t & u 6' & Q & ;H(  , ( G0A@ "0<7<&iBinto60>EG?E)AE3CD^~AIFS U 0IB+GQHF uj D hE# fF#?+Fiu) - /% - =~# / #  # 6  # # # O# # z# #$ #( #, =~#0 #4 .~#8 ~#< w#@ o">#D #p#F $#G b(#H {1#L 7#T ;8#X [:~#\ !<#`5  d ~k  T~# # 2 ~#G@3Vtm,w x~# y~# z~# {~# |~# }~# ~~# ~# ~# f#$ Z/#(2>q40Ya7 l Y  p#/ > f   # # # ) # ! #  ##3w x ڨ# w# X ܍# x#7 b#   ]# # # bit~#u32"0 ?Z* _+#key, # dInd#pd#?   - ?#ref!d#  H0wq1#rq2# v 3~#0 4~#4 50#8 6$#< 7#@ 8~#D 74w x:# Iy?# `z0# x {0# b&|0# r}0# [ ~0# =0# -0#$ u#( n(8!H v !I0#  !J0# R!K#fd!L~# =!M0#exp!N0# 3!O# 4!P# w3!Q# $4!R#$ib!S #(ob!S #, b !T0#0 !U#4 !S =}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 W 0#4 ~#8 "( #< 7#@ 7#A W#D J#L a #P  #T  #X 1 .tstru#lenv~#B B  H  Z z I ?# L ?# # $ #fe #be #  ~# = ~#$ . 0#(req  #,rep  #0si "#4 # # #  3#srv p# 3 p# A p# . "#txn # r ~#  #  "# 0 "#  w#  w#  ׂ"# { 0#1   ] 7 +n k  # !7 #G kz auid ^6#gid _ # \ `+# bux aG $ Lfd M~# v N~# + O~# A= P# Q# l R~# # S~#  T0# U U#  V?# ( W# ? X$# % Y# # Z# W [0#  bz # u( c#  T Q u m#  n~# - o~#  p~# q# rV#  s~#$ Q3 t#( h4 u#,  v#0 c w#4 > x#8  y#< ? z?#@ < {~#H I |?#L  ~~~~%Cf%A#b%B # O %?cb%CO# R%D# v %E7#ev%F7# %G_# %HV#_ ~p7A=4un5 in63 p2u7j#&R &N~# &O~# +&P~# &Q~# N &;uid&<~#gid&=~# &>~# #&?~# &@~# &A~# &B~# 8&C~# \&D~# ?&E~#$ &F~#( &G#, '&H#0 J&I~#4 &I~#8 J&J~#< R&J~#@ &K~#D &K~#H A &L#L I &L# &R# &S # c&T~#   N# # ~# P# ?#N* a ^# _%# B`%#a 5?+ U,5# -;# .~# //# A  o { d# #{{o  $8len$90#cr$:0#U$;0# % $Cv$D# [ $Ew# `$Fw# ($Gw# 2$Hw#  b#!!!a! ! !!!! ! . ##l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~#8#rq#mst# D# : #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap##sl## | #W#8 #~#@ # 1#b# %## # #req#8#rsp#8#\uri## ## ## nG#~# =#0# ZD  0# V 0# 0#p*>| H U Ip# v J~#  K~# v L~#  M~# N#  O# & Q #  R~#  S~#$ S~#( # T0#, 6 T0#0 d U~#4  U~#8  V~#< K W?#@ X#H A= Z3#L 3 [3#\ {= ]3#l o _~#| o `# @ bp#  bp#  c# _ d3# N ew#  f~# g~# ; g~# " h~# h~#  h~#  i~#  j~# F k~#id m#  n0# L n0# o0#  p0# O q0#  r0# V r0# g s# v t # h up#  wi# wi# Z x0# yA#  {i#  {i#  |i#  |i#  }i#  ~# 0#  i# ~ i#  i# % i# , ~# &hD Q p # # ) # v ~# + ~# I ~# \ ~#  3#  ##,acl ?#0 ] ?#8  ?#@  ?#H < $#Psrv p#\ 9 ~#` ) ~#d R $#h U # J #  ~# c #  ~#  0#  ~#  ~# K # ~# & ~#  #  ~#  ~# y F# 1 # R ~#  ~# S, 1&#  #  ~# Z ?# % %#id # K ?# d ~#  ~# d ~#  0# w 0# \ 0#  0# #  0#  # 0#  i# X i# ~ i# # 0# } 0# 7 0#  # N #  # h #  # ` ~# ( #  ~# 0# Z 0# A#  i#  i#  i#  i#  i#  i#  i#  i# % i#  ~#cap ~# 3 3# {= 3# o ~# o # U  # A # I # J p#  p# J ~# R ~#  ~# ~# ~# q ~# p ~#  ~# D 5# n 5#  ~# 1 ~#  =&# 4 =&#  #  # ] # { C&# } C&#  ~# a #  ~#  S&#  ~# w !~#  "0# #0#  $m##  $m##Hv % " I" ?# "!B #srv""p# !D ~# z L# L#  L#  # s # #$ $ P#( Q P#, ( P#0  i#4 % i#<" px Ƥ #sv p#  w#  w# = 0# iid ~# G ~#sid ~#&"  j#" iid ~#px Ѥ #buf 0#sid 0# ptr ~#bol ~#" >' ˘! " &"" "B ""B "G m#L , z  {#t0 |#t1 |# 7 } # U ~ #  ~#  ~#$  ~#(#  L#len 0#pos 0# sid 0#srv p#oe #src #buf # $ be u .$  0# < ?#a$ srv a$# ~# v ~#p$X act "#bck "#,$ act #bck #%  ~# % ~# ~#  ~#  ~#  ~# ~# p#map .$#  g$#, F $# > %# 6 %# u7 %#  %#  %#%p%+&  ~# 1 ~# Q7 ~# 9 ~# *> ~# ~# 3 ~# ~#S,+& 7&S& c& "&A?U#fmt@/$%hB&tmCH'&(&D(&P)&*now&*tm& A"L'V@U#fmtU/$%hW&tmXH'&Tk(&D(&P"'jU#outi'S#fmti/ $%hk+'by~5U#levx/V,Oz~S-#%}%%s}%+=(p~@uU#fac/V,x~S-Uh%%%s%""*U#p V.O~ .?,/S$,F~@f,\~Df,"Hf%h,"*o,s,K~~,~P,~,3*,,,2,;,B~W,~,S/),I*P0 ~R0US1))0I*V0U0~P'T*2e*-&tm'&.(&(&P3*C*C*O* 3q*7~4I*5p+CU6sBB S7pnD7feE V7beF ~0G ~0H~W0OH~~7errH~~0|I~7tmJ~8?+&(&~(&P1Y+9__vw>-DT9__vv>:2': ':&':%t+:%u~: &[~+;:Q+:G'=L:&W: &XEG?E)AE3CD^AIFS U 0IB+GQHFpj !Dh!E#f!F#    b#  p  ]x### bit#u32"0'Z*_+#key,#LInL#pL#'{ - '#ref!L#74 w x#I y'#` z0# x {0#b& |0#r }0#[ ~0#= 0# - 0#$u #( * 02>q40Y57 @|Y pV#$/>f ##  )#!##  wWڇ#K#X a#W# g7 ) -r% -= #/ # #6 #  # #O # #z #  #$ #( #,= C#0 I#4. #8 #<w #@o ">#D #p#F $O#Gb (_#H{ 1#L 7#T; 8#X[ :#\ ! <e#`d Ck T C# I#2 # r _  u 3 H0wq1#rq2#v 3#04#450#86#< 7#@8#Dun(8 Hv I0# J0#R K#fd L# = M0#exp N0#3 O#4 P#w3 Q# $4 R#$ib S; #(ob S; #,b T0#0 U#4 ;  S= }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0W 0#4 #8"( $ #< 7#@ 7#A W#DJ #La #P 0 #T 6 #Xj . tstr u#len v#{ { ;  $ Z  zI '#L '# #$ #fe #be # # = #$. 0#(req ; #,rep ; #0si #4 ## # #srv #3 #A #. #txn 4#r # 7#  #0 5 # ‚# Â# #{ 0#j * G ]p +nk  #!p # k auid^1#gid_#\`&# buxa  $ LfdM#v N#+O#A=P#  Q #lR##S#T0#UU #V'#(W #?X#%Y ##Z#W [0#b #u(c# TQum #n#-o#p# q# r|# s#$Q3t #(h4u #,v#0cw#4>x#8y#<?z'#@<{#HI|'#L       ) Cf A #b B; # ?cb C#R D#v E7#ev F7# G# H|#   N###P# '#{5 a^#_%#B`%#a?+U,#-#.#/*# @5{ L## $8len$90#cr$:0#U$;0#g% $Cv$Dg#[ $E#`$F#($G#2$H# #a    . #m#l#݉#m_l#މ#u#߉#u_l#߉# v##v_l##k#l##v_l##c##c_l## r##r_l###rq#st#.D#: #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#.#sl#k# | #W#8##@#1##%## #A #req##rsp##\uri## ####nG##=#0# ZD 0#V 0#0#*>|HUI#v J# K#vL# M# N# O#&Q#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KW'#@ X#HA=Z#L3[#\{=]#lo_#|o`#@b#b#c#_ d#Ne#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v t#hu#wi#wi#Zx0# y<#{i#{i#|i#|i#}i#~# 0#i#~ i#i#%i#,# &hDQp # a#)a#v # +#I#\##|!#,acl'#0]'#8'#@'#H<!#Psrv#\9 #`) #dR B"#hU#J #ĉ#c#Ɖ#0#ȉ#ɉ#K# ˉ#& ̉##Ή#ω#yЖ#1 #R҉#Ӊ#S,###։#Z'#%C##id#K'#d# #d#0#w0#\0#0# #0## 0#i#Xi#~ i##0#}0#70#a#Na#a#ha##` #(##0#Z0# <#i#i#i#i#i#i# i#i#%i## cap#3#{=#o #o #U #A  j #I  j #J p# p#J#R## # #q#p##D #n##1###4####]#{##} ###a ####  #w!#"0# #0#$ #$ #Hx7% "I" '#"!{ #srv""# D  #z G# G#  G# #s #  #$$ P#(Q P#,( P#0 i#4% i#<_ px #sv # Ȃ# Ȃ# = 0# iid ʉ#G ʉ#sid ʉ#v  R# iid Љ#px #buf 0#sid 0# ptr ԉ#bol Չ# >'   _ v   {  5 { $ Gj p7 A=4un5G in6 p2u7B # L ,z{x#t0|x#t1|x#7}#U~## #$#(|!G#len0#pos0# sid0#srv#oe#src#buf6 #!be u! 0#<'#! srv!# #v #"Xact #bck #,B"actx#bckx#1##% # ## ## # #map!# !#,F"#> =##6=##u7=## =##=##=#1## ى#1ډ#Q7ۉ#9܉# *>݉# މ#3߉# #S,# # # #A !?$T#U" SS#?$$P$#Z$$g$%Z$ v&tu's$](|\s$)$500U*t/S+,|5P!&ZyU"Ux V, zW-eb{s$S.%&$0&/:&P.R%E&$V&#b&$t&#&/&P$&.%&6$&#&6$&061&R#&)6/&P$&.%?$69$P$#Z$69$g$.%&L`$ '/'P.& '`$-'#9'$J'$S'%E&_&t1^&t2^%b&u7s$( 62&6&3 52&&3)3D0%&PCs$(|Bs$2&mT&3_S&4tU% 'k(j&nowj'9'( %]'7h&tg&fg0!(rU"U -tS-ebs$V, 0W,p. (&6j$&#&6j$&06j1&P#&Xg/&P$&.5((jp$(#Z$jp/g$P.L( '$-'.h(($($(#E&=M$V&#b&=M$t&#&=M/&P$&%(&t%(&t1&t25)U6])7__sF) 0 > 77__u)7__cw+7__s) 0 > 77__u)7__cw)m)82)g8 )8 t))8 u *9 8%Q)8&;0:now&#H {1#L 7#T ;8#X [:h#\ !<D#` d"k T"#(#2 h#Q >  T 3"n(8Hv I%# J%#RK# fdLh# =M%# expN%#3O4#4P4#w3Q4# $4R4#$ ibS#( obS#,b T%#0U#4..T" S= }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0W %#4 h#8"( #< ,#@ ,#A A#DJ .#La .#P #T #X:Z  ]hhC fA# bB#_ ? cbC_#RD#v E,# evF,# Go#H# o  -hkUtv1,Qtv2,Shtv1tv288pUtv8S mshQ6h!Utv15Qtv25Rhtv1tv2Ah0Utv1@Vtv2@W<I#0*htv1)tv2)K:Utv1JVtv2JS ![:tv1Ztv2Z J:tv1Itv2I"retK: LU:LUtv1TWtv2TSX  G# G! a:PUtv1`Stv2`R[w ($P: \i8Utvh8VhRinchP: L W c p [w8tvv8%vincv rhUtvq8SqVincqQ     htv8%incd n{8 Utv1zRtv2zPtvz8Vd .Iv    m8tv1tv2tv8- 8Utv1Stv2Rtv8Q - ? K W d v   c t c 8tv1tv2tv8 o8tvn8  h@Utv1Qtv2R '   htv1tv2C h@pUtv1Qtv2RC IWT _ k htv1tv2&M=p/UhS)h 't'p'dh(y(: L W c M^i9M^iu uhtv1tv25x8tvx80FUthSaQ)rvt)p͓p)cnthl  *2 F*  *t,*uh P+ * Q?,%,%,%-now,G, G+P  G0A@ <7<&^Bint3CDSAI 0) -a% -=s#/ # #6  #  ##O# #z# #$#(#,=#0#4.s#8s#<wz#@o">#D #e#F$#Gb(#H{1#L7#T;8#X[:s#\ !<#`g dk  T# # 2 s#s  l  3 / >f   # # + n(8H v I0#  J0# RK#fdLs# =M0#expN0# 3O # 4P # w3Q # $4R #$ibSZ#(obSZ#, b T0#0 U#4+Z S =}0#rex~s#wexs#rtos# wtos#ctos#l0#r#w# lr#$ >0#( 0#, 0#0 W 0#4 s#8 "(}#< 7#@ 7#A L#D J#L a #P #T #XqqZwZ ` ]ssCfA#bBZ#6 ?cbC6# RD# v E7#evF7# GF# H# F +<] #^# >_E#set`E#clraE# q?bE# >cE#remdW#cloeW# f3ft# 7g#$ r@h#( $i#, Ej#0 uka#4 ls#8@s@s s+W@KnnsL]snzn%PUfd$sS1 U0ap2sV5%s5%I>sUp?sQbp@nVuWUbpYnpZsVisUouthpjsS (ksh UksW 5lspbpmnl!sU"2" # L`#s$t J L #: #n (t#sX# s# s $ " Q O ..O A@  "%<7Binto 6% >:G ?:) A:hAI % IB+GQz $I  n $# p $# 74w x# Iy# `z%# x {%# b&|%# r}%# [ ~%# =%# -%#$ u#(  23q 4%Y7  Y  p#/3 Tf   # T#d  ) # !o# #w   # # X # #, )+n k  # !)#9k ap7 A=4+un5in6 zp2 u79# b#z ]### bith#u32"% 1Z* _+# key,#  H0 wq1# rq2# v 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _# \ `#  bux a $ L fd Mh# v Nh# + Oh# A= Pd# Q# l Rh# # Sh#  T%# U U#  V# ( W# ? X# % Y$# # Z# W [%#  b# u( c#  T Q u m*#  nh# - oh#  ph# q # r#  sh#$ Q3 t#( h4 u#,  vJ#0 c wJ#4 > xJ#8  yJ#< ? z#@ < {h#H I |#Lhhh:Jh:R Nh# Oh# +Ph# Qh#  ; uidh# #?h# @h# Ah# Bh# 8Ch# \Dh# ?Eh#$ Fh#( G#, 'H#0 JIh#4 Ih#8 JJh#< RJh#@ Kh#D Kh#H A La#L I La# RP# S# cTh# 8   h# J!h# a "h# U#8 #  )&8 Uret'8 (p@__p5S 2IUpH8 S <V XUpU8 R d`U f!E"W#{ 8t*#p8 4t#Zh0t#eh,tt& (2S G0A@ "0<7<&iB5into60>EG?E)AE3CD^AIFS U 0IB+GQHFpj  Dh E#f F#|  a^#_%#B`%#ae jh#i#j??+U,?#-E#.#/v# K 2>q40YP7 [Y pq#$/>f ##  )#!## - wrڢ#f#X |#r# 7 ) - % - =# / #  # 6  # # # O# # z# #$ #( #, =d#0 j#4 .#8 #< w#@ o">#D #p#F $p#G b(#H {1#L 7#T ;8#X [:#\ !<#`ddk Td#j#2 #-  &  3 b#    ]# # # bit#u32"0MZ*_+#key,#rI n r#p r#M - M#ref !r# H0wq1$#rq2$#v 3#04#450#862#< 7#@8#D,,,74w x #IyM#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$u#(  n(8 Hv I0# J0#R K#fd L# = M0#exp N0#3 O#4 P#w3 Q# $4 R#$ib S #(ob S #,b T0#0 U#4  S= }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0W 0#4 #8"( #< 7#@ 7#A W#DJ #La #P  #T #X? . tstr u#len v#P P  V  Z  zI M#L M# ,#$ #fe p#be p# # = #$. 0#(req  #,rep  #0si x #4 ## # -#srv <#3 <#A <#. #txn #r # # #0 # w# w# N #{ 0#?   ]E +nk  #!E # U k auid^1#gid_#\`&# buxaU  $ LfdM#v N#+O#A=P#  Q#lR##S#T0#UU#VM#(W#?X2#%Yp##Z#W [0#b #u(c# TQum#n#-o#p# q# r# s#$Q3t#(h4u#,v#0cw#4>x#8y#<?zM#@<{#HI|M#L      Cf A#b B #W ?cb CW#R D#v E7#ev F7# Gg# H# g p7A=4un5 in6-p2u7m# N###P# M#8;{ r#M#GG; #8len#90#cr#:0#U#;0#% #Cv#D#[ #Ew#`#Fw#(#Gw#2#Hw# S."   a        . " "l"݉#m_l"މ#u"߉#u_l"߉# v"#v_l"# "l"#v_l"#c"#c_l"# r"#r_l"#"rq"9st"D": "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ڪ#sl"# | "W#8"#@N"1".#%"# " #req"#rsp"#\uri"# "#"#nG"#="0#ZD 0#V 0#0#<*>|HUI<#v J# K#vL# M# N# O#&Qp#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KWM#@ X,#HA=Z-#L3[-#\{=]-#lo_#|o`#@b<#b<#c#_ d-#New#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs$#v tv#hu<#wi#wi#Zx0# y<#{i#{i#|i#|i#}i#~N# 0#i#~ i#i#%i#,#p&hDQp# |#)|#v # +#I#\#-#!#,aclM#0]M#8M#@M#H<!#Psrv<#\9 #`) #dR }"#hU#J #ĉ#c#Ɖ#0#ȉ#ɉ#K# ˉ#& ̉##Ή#ω#y#1 #R҉#Ӊ#S,###։#ZM#%~##id#KM#d# #d#0#w0#\0#0# N#0#N# 0#i#Xi#~ i##0#}0#70#|#N|#|#h|##` #(##0#Z0# <#i#i#i#i#i#i#  i# i# %i# #cap# 3-# {=-# o # o # U p# A  # I  # J p#  p# J# R# # # # q# p# # D ?# n?# # 1#  $# 4 $#  #  # ] # {$# } $# # a # # $#   # w!# "0# #0# $9!# $9!#HB% !I! M#!!P #srv!"<# dD  #z G# G#  G# #s #  #$$ P#(Q P#,( P#0 i#4% i#<  px p#sv <# w# w# = 0# iid ʉ#G ʉ#sid ʉ#   x# N  iid Љ#px p#buf 0#sid 0# ptr ԉ#bol Չ#x  >' d    | P   P  G9!L ,z{#t0|#t1|#7}v#U~v## #$#(!G#len0#pos0# sid0#srv<#oep#src#buf #!bepu ! 0#<M# -" srv-"# #v #< X"Xact #bck #, }"act#bck# l##% # ## ## # <#map!# 3"#,FX"#> x##6x##u7x## x##x##x#<l# # ى#1ډ#Q7ۉ#9܉# *>݉# މ#3߉# #S,# $ $ /$ !%dU"dstW"src "strvV#%$p%$ &len#S&num#P'X$/7Q$/7P%$,6(2'p(3% !B%EvpU"strDvS&errFvV!%fvSU#<d%S#dER#eR#evV)expg?*&errjvP?+K%% >+UL%% ~+M% & ,%+2&&+ &&+ tF&+ u j&- +$QY&gJ7z` G0A@  "0 #[< %m7< &B 5into 60 =b >EG ?E @P) AE BE3 C DtAIF S UB ll q  0) '-s% '-=(#/( #( #6 ( #  (#(#O(# (#z(# (#$(#((#,=(`#0(f#4.(#8(#<w(#@o(">#D (##F($l#Gb((|#H{(1P#L(7f#T;(8f#X[(:#\ !(<#`  7 f d(`k ( T(`# (f# 2 (#)s | "  3IB+GQHF$j !D h!E$# f!F/#2>q40Y7 .Y  p#$[/>mf  9# m# }   )9# !# #  w  9# # X #  # 7 rr Ls# t# u# yv# w#DQ"3 "4# "5# T"6#  "7# {"8# "9# ":#,#, - #-# N#.# #/# #0# Q^ X&% E &&# &'># &)# &-# ~&.# &/# &0# = &1# ;&2>#( &4#, &8:#0 l &;E#4 &?$#8 !&@[#< &A$#@ !&B[#D 9&C$#H &D[#L !&F[#P &G[#T t  b t#  Q  ] Y# # # bit #u32 "0Z * _ +#key ,#-I n -#p -#\  - #ref !-# H 0wq 1#rq 2# v 3#0  4#4  50#8  6#< 7f#@  8#D\ 74w x# Iy# `z0# x {0# b&|0# r}0# [ ~0# =0# -0#$ u #(   j n(8+H v +I0#  +J0# R+Kf#fd+L# =+M0#exp+N0# 3+O| # 4+P| # w3+Q| # $4+R| #$ib+S #(ob+S #, b +T0#0 +Uf#4v v  j  +S = }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$ > 0#(  0#, 0#0 W 0#4  #8 "( #< 7#@  7#A m#D J v #L a v #P  #T #X  . tstr u#len v#     Z  z I,# L,# ,# $ ,P#fe,} #be,} # ,# =,#$ . ,0#(req, #,rep, #0si,"#4 ,}# #,}# ,#srv,I# 3,I# A ,I# . ,"#txn,# r ,# , # ,"# 0,"#  ,# ,Í# ,["# {,0#  ]+n k  9# !#  kC auid^#gid_# \`#V buxa]$ LfdM# v N# +O# A=P}# QJ# lR# #S# T0# UUP# V# (Wf# ?X# %Yl# #Zf# W [0# bC# u(c#J TQ umr# n# -o# p# q9# r.# s#$ Q3tf#( h4uf#, v#0 cw#4 >x#8 y#< ?z#@ <{#H I|#L]VfV  J*Cf*Af#b*B # *?cb*C# R*Df# v *E7#ev*F7# *Gr# *H.# (    N# # # [# #- a ^f# _%# B`%#a?+ U,# -# .# /#   N { -# `#ZZN /8len/90#cr/:0#U/;0#% /Cv/D# [ /E# `/F# (/G# 2/H# fA.a    . ..l.ݟ#m_l.ޟ#u.ߟ#u_l.ߟ# v.#v_l.#.l.#v_l.#c.#c_l.# r.#r_l.#.rq.Lst.D. : .0#sol.#eol.#som.0# col.0#sov.0#eoh.0#cap.#sl.# | .m#8 .#@[. 1.A# %.# . #req.#rsp.#\uri.# .# .# nG.# =.0#ZD  0# V 0# 0#I*>|H UII# v J#  K# vL# M# N#  O# &Q} # R# S#$ S#( #T0#, 6T0#0 dU#4  U#8 V#< KW#@ X#H A=Z#L 3[#\ {=]#l o_#| o`# @bI# bI# c# _ d# Ne# f# g# ;g# "h# h# h# i# j# Fk#idm# n0# L n0# o0# p0# Oq0# r0# Vr0# gs# v t # huI# w# w# Zx0# y# {# {# |# |# }# ~[# 0# # ~ # # %# ,#} &hDQ pP# # )# v # +# I# \# # $#,acl#0 ]#8 #@ #H <$#PsrvI#\ 9 #` ) #d R %#h U# J # ğ# c# Ɵ# 0# ȟ# ɟ# K# ˟# & ̟# # Ο# ϟ# y%# 1 # Rҟ# ӟ# S,Ԁ'# # ֟# Z# %&#id# K# d#  # d# 0# w0# \0# 0# [# 0# [# 0# # X# ~ # #0# }0# 70# # N# # h# # ` # (# # 0# Z0# # # # # # # # ##%##cap#3#{=#o #o #U } #A  ##I  ##J # #J#R## # #q#p##D #n##1#'#4'###]#{'#} '##a ##'#  #w!#"0# #0#$E$#$E$#HOY % - I- # -! #srv-"I# q!D, ,# z,# ,# ,# ,# s,# ,#$ $,[#( Q ,[#, (,[#0 ,#4 %,#<!,px,} #sv,I# ,ȍ# ,ȍ# =,0# iid,ʟ# G,ʟ#sid,ʟ#! , ,3#[",iid,П#px,} #buf,0#sid,0# ptr,ԟ#bol,՟#", >',q! ,! ,! "  " "" v "G!*#acl%*I%+#u%,#cA%-#  %.#%/0#"#{A%>I%?#;%@#pol%A#%B0#,%C##p7 A=4Dun5 in6#p2u7##E$L ,z {Y#t0|Y#t1|Y# 7} # U~ # # #$ #($ #len0#pos0# sid0#srvI#oe} #src}#buf #$be} u%  0# <#9% srv9%# # v #Id%Xact##bck##,%actY#bckY#x& # % # # # # # # I#map%# ?%#, Fd%# > &# 6&# u7&# &# &#&Ix&'  ٟ# 1ڟ# Q7۟# 9ܟ# *>ݟ# ޟ# 3ߟ# #'S,  &# '# Y(# 4)# =*# -+)# ,*# U-'#''  U'# u# Z#len # !# C"#' '  ( "0(-#6+} #u,j('I(#B)j(#be-(# 0#)O(0I1#B2j(#G3# 4#%5#6#=70#8# 9#$;) $$ ^$%#kw$&# $-d)#d)} } ;))$5 I$6#kw$7)# ))$)  U)# # #)*  U*# # 7#)\*2R 2N# 2O# +2P# 2Q# + 2;uid2<#gid2=# 2># #2?# 2@# 2A# 2B# 82C# \2D# ?2E#$ 2F#( 2G#, '2H#0 J2I#4 2I#8 J2J#< R2J#@ 2K#D 2K#H A 2L##L I 2L## 2R*# 2SV# c2T#,5 S uT#valU0#capV0# W0# %- P`hU&str~'2PV(lPP(cP)U~)S)\~)TS(endW*j +-(ss}~,,-__sf.--V]/-0-V]/-/./..7--]g/-0-]g/-/./..k--gx/-0-gx/-/./.,-(__v>P1 (__v>P+--__sf2(he.P3-n4m3. -4+4O+4,5.pU6&} V7capQ6*6,7arg68msgS0./.9.2:&1} 5//AU6&} P6* 6,7arg5/C*PU6&)} P6*) 6,)7arg)5/7U6&6} P6*6 6,67arg6570 !DU6&C} P6*C 6,C7argC50 QAU6&P} P6*P 6,P7argP50 \PU6&[} 6*[W6,[V7arg[S5;1M!e8U6&d} 6*dW6,dV7argdS51+m@U6&l} 6*lW6,lV7arglS5W8v>U6*u6U u 6<u7invu+ 2;x%;sx%,12;|%;s|%,W2;%;s%,}2;%;s%,28E;%;s%,2IV;%;s%,2;%;s%,3;%;s%,;3;%;s%,a3;%;s%.3-,/-0-,/-/./.,38E;%;s%.3-et/-0-et/-/./.,94;%;s%1;<P.m4-/-0-/-/./.+4__sf08D/8?88:&7} 5g_fPyiU6*6U  6<7inv<} Ht< IS8errP8rc}8val0~+9;%;s%,9;%;s%,9;%;s%.9."8/..:8/8.':g_j@y_~@_~,M:;%;s%,s: ;%;s%+:;h%;sh%,:;%;s%+;<P~X  ;#%;s#%1  ;#<#P1  ;&%;s&%,>0R;:%;s:%10R;:<:P,>+8;M%;sM%,>@M;%;s%,?Ub;%hdr',yBIn;%;s%1In<R<P0-/-0-/-/./.,Ban;%;s%,Bv;%;s%,C>hdr',[C;%;s%1<R<P0-@C/-0-@C/-/./.,C;D%;sD%,C ;%;s%+vD88polS;e%;se%.F-Wo/-0-Wo/-/./.,P,UM..;%;s%1..;<P2(wN0-15O5/-0-15O5/-/./., R55;%;s%,0Ru66;%;s%+HR8err3P+`R8err$P+xR8errP,R\8~8; %;s %1\8~8; < P+ S< #~>; %;s %,2U??;z %;sz %,XU,@;@; %;s %,~UAA; %;s %+U< "S+U8lPP2__v>,UBB>__v>.$V_CC/_0-CC/-/./.+`V I;v%;sv%1 I>I;v<vP,WFIYI;{%;s{%,WII;%;s%,W7JDJ;%;s%,XLJYJ;%;s%.BX-KK/-0-KK/-/./..vX-KK/-0-KK/-/./.,XMM;% %;s% %+Xh <& "S,X}NN;b%;sb%,YNN;e%;se%,&YOO;< %;s< %+>Y <= "S,dY-P:P;S %;sS %+|Y <T "S,YPP;j %;sj %,YtQQ; %;s %+Y < "S,ZS S; %;s %+Z < "S,DZTT; %;s %+\Z < "S,ZdUqU;%;s%+Z PznzU7kwlc8PD~epzzU7kwlc8P2X ;j-E2'eE 'eE)Kee >EU)Lee E)MeE*teE*u fF E0QeE  G&<} G=HzLfH@tE1;0Inow1<E2W\*E?2\E2]  f( E3f fEc3E3E4Q0E4R0E4U0E 4VE 4Wg 4g ~H 9Fg $g [g[g  +)"[qg Kg g[g )(wg@ vg)[Dt)L O`t) j)Pf$" SG?S)AS3C7DlAIFS7 U7 0I B+ G QHFej DhE#fF#k 2Lq40 Yp7 {Y  p #$/Lf ##  =)#!#=# M w  # ۆ#X ܜ# # E ) -@% - =># / #  # 6  # # # O# # z# #$ #( #, =#0 #4 .>#8 >#< w#@ o"L#D #~#F $#G b(#H {1#L 7#T ;8#X [:>#\ !<#` dk T##2 >#M  F  3   b #  9   ] #  #  # bit >#u32 "0mZ *_ +#key ,9#In#p#m - m#ref!#< H 0wq 1D#rq 2D#v 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<74w x@#Iym#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$u#(  n(8Hv I0# J0#RK#fdL># =M0#expN0#3O#4P#w3Q# $4R#$ibS0 #(obS0 #,b T0#0U#40 S=}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#, 0#0W 0#4>#8"( #< E#@E#Ae#DJ#La #P% #T+ #X_ .tstru#lenv>#p p 0 v  Z zIm#Lm# L#$  #fe#be#># =>#$. 0#(req0 #,rep0 #0si#4 ###M#srv#3#A #.  #txn)#r >#,# #0* # …#Å##{0#_  < ]e +nk  #!e # u k auid^&#gid_#\`# buxau  $ LfdM>#v N>#+O>#A=P#  Q #lR>##S>#T0#UU #Vm#(W #?XR#%Y ##Z#W [0#b #u(c# TQum #n>#-o>#p># q# r# s>#$Q3t #(h4u #,v #0cw #4>x #8y #<?zm#@<{>#HI|m#L   >> >  >  CfA #bB0 #} ?cbC}#RD#v EE#evFE# G#H#   N##>#^# m#X* a^#_%#B`%#az?+U,z#-#.>#/e# 5 *{ ##  "8len"90#cr":0#U";0#\% "Cv"D\#[ "E#`"F#("G#2"H# !a    . !b !l!>#m_l!>#u!>#u_l!># v!>#v_l!>#`!l!>#v_l!>#c!>#c_l!># r!>#r_l!>#}!rq!st! #D!: !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!##sl!`# | !e#8!>#@!1!#%! # !6 #req!}#rsp!}#\uri!# !#!#nG!>#=!0#ZD 0#V 0#0#*>|HUI#v J># K>#vL># M># N# O#&Q#R># S>#$ S>#(#T0#,6T0#0dU>#4 U>#8V>#<KWm#@ XL#HA=ZM#L3[M#\{=]M#lo_>#|o`#@b#b#c#_ dM#Ne#f># g>#;g>#"h># h>#h>#i>#j>#Fk>#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsD#v t#hu#ww#ww#Zx0# y1#{w#{w#|w#|w#}w#~# 0#w#~ w#w#%w#,>#&hDQp # #)#v ># +>#I>#\>#M#q!#,aclm#0]m#8m#@m#H<!#Psrv#\9 >#`) >#dR 7"#hU#J #>#c#>#0#>#>#K# >#& >##>#>#yЋ#1 #R>#>#S,Է###>#Zm#%8##id#Km#d># >#d>#0#w0#\0#0# #0## 0#w#Xw#~ w##0#}0#70##N##h##` >#(#>#0#Z0# 1#w#w#w#w#w#w#  w# w# %w# >#cap># 3M# {=M# o ># o # U # A  _ # I  _ # J ~#  ~# J># R># ># ># ># q># p># ># D z# nz# ># 1># ## 4## # # ]# {## } ## ># a # ># ##   ># w!># "0# #0# $ # $ #H,%  I m# !p #srv "# D >#z<# <# <#7#s7#  7#$$^#(Q ^#,(^#0w#4%w#<Tpx#svǵ#ȅ#ȅ# =0# iid>#G>#sid>#k ͘#iid>#px#buf0#sid0# ptr>#bol># >' T k    p  * p  G_ p7 A=4un5< in6Mx p2u77 # L ,z{#t0|#t1|#7}#U~#># >#$>#(q!<#len0#pos0# sid0#srv#oe#src#buf+ #!be u! 0#<m#! srv!# >#v >#"Xactx #bckx #,7"act#bck#&#>#% ># >#># >#># ># #map!# !#,F"#> 2##62##u72## 2##2##2#&## >#1>#Q7>#9># *>># >#3># >#S,# # # #6 !$l!>zzU"sQ!7$!>z"{U"sR#2D$# D$#td$#u> $$ ##Qw$%now$<<02!WԒ0{" G0A@  "0<7< &iBinto 60 >EG ?E) AE3 C D^AIF S U  0IB+GQHFej "Dh"E#f"F#) '-p% '- =(~# /( # ( # 6 ( # (# (# O(# (# z(# (#$ (#( (#, =(R#0 (X#4 .(~#8 (~#< w(#@ o(">#D (#p#F ($^#G b((n#H {(1#L (7#T ;(8#X [(:~#\ !(<t#`   d(Rk (T(R#(X#2 (~#p n   3 / >f   # #    ) #! # #  wFC 6  7~# A 8~#2>q40YF7 QY pg#ڏ#\#X r## 7  b#  e  ]# # # bit~#u32"0Z*_+#key,e#In#p# - #ref!#h H0wq1p#rq2p#v 3~#04~#450#86~#< 7#@8~#Dxxxh74 w x#I y#` z0# x {0#b& |0#r }0#[ ~0#= 0# - 0#$u #( - n(8$Hv $I0# $J0#R$K#fd$L~# =$M0#exp$N0#3$O #4$P #w3$Q # $4$R #$ib$S\ #(ob$S\ #,b $T0#0$U#4-\ $S=!}0#rex!~~#wex!~#rto!~# wto!~#cto!~#l!0#r!#w!# lr!#$>!0#(!0#, !0#0W !0#4!~#8"(!E #< !7#@!7#A!W#DJ!#La !#P!Q #T!W #X .!tstr!u#len!v~#  \  E Z !zI##L## #x#$ # #fe#4#be#4##~# =#~#$. #0#(req#\ #,rep#\ #0si#&#4 #######srv#!#3#!#A #!#. #&#txn#V#r #~## %##&#0#'# #w##w##ץ&#{#0# K h ] +nk  #! # k auid ^&#gid _#\ `# bux a  $ Lfd M~#v N~#+ O~#A= P#  Q #l R~## S~# T0#U U # V#( W #? X~#% Y ## Z#W [0# b #u( c# T Qu m# n~#- o~# p~# q# r#  s~#$Q3 t #(h4 u #, v##0c w##4> x##8 y##<? z#@< {~#HI |#L   ~~ ~  #~ J)Cf)A #b)B\ # )?cb)C#R)D#v )E7#ev)F7# )G#)H# ) <)]#)^#>)_#set)`#clr)a# q?)b#>)c#rem)d#clo)e#f3)f# 7)g#$r@)h#($)i#,E)j#0u)k#4)l~#8~~ ~~~=p7A=4un5h in6Vp2u7#,R,N~#,O~#+,P~# ,Q~#  ,;uid,<~#gid,=~#,>~##,?~# ,@~# ,A~#,B~#8,C~#\,D~# ?,E~#$,F~#(,G#,',H#0J,I~#4,I~#8J,J~#<R,J~#@,K~#D ,K~#HA ,L=#LI ,L=#,RV# ,S #c,T~#8 &8len&90#cr&:0#U&;0#% &Cv&D#[ &Ew#`&Fw#(&Gw#2&Hw# %   a        . %6%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%6PD%: %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%P#sl%# | %W#8%~#@%1%#%%8# %b #req%#rsp%#\uri%# %#%#nG%~#=%0#G N##~#P# # a^#_%#B`%#aX?+U,#-#.~#/#  { #'#!!GG:h&hDp # r#)r#v ~# +~#I~#\~##"#,acl#0]#8#@#H<"#Psrv!#\9 ~#`) ~#dR X##hU#J #~#c#~#0#~#~#K# ~#& ~##~#~#y#1 #R~#~#S,$##~#Zי#%Y$#id#K#d~# ~#d~#0#w0#\0#0# h#0#h# 0#i#Xi#~ i##0#}0#70#r#Nr#r#hr##` ~#(#~#0#Z0# 1#i#i#i#i#i#i#  i# i# %i# ~#cap~# 3# {=# o ~# o # U 4# A  =# I  =# J p#  p# J~# R~# ~# ~# ~# q~# p~# ~# D # n# ~# 1~# $# 4$# R# R# ]R# {$# } $# ~# a # ~# $#   ~# w!~# "0# #0# $"# $"#HZD 0#V 0#0#% I #! #srv"!# !*>|"UI!#v J~# K~#vL~# M~# N# O#&Q4#R~# S~#$ S~#(#T0#,6T0#0dU~#4 U~#8V~#<KW#@ Xx#HA=Z#L3[#\{=]#lo_~#|o`#@b!#b!#c#_ d#New#f~# g~#;g~#"h~# h~#h~#i~#j~#Fk~#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsp#v t!#hu!#wi#wi#Zx0# y1#{i#{i#|i#|i#}i#~h# 0#i#~ i#i#%i#,~#"L ,z{#t0|#t1|#7}!#U~!#~# ~#$~#("<#len0#pos0# sid0#srv!#oe4#src#bufW #"be4u" 0#<## srv## ~#v ~#!3#Xact!#bck!#,X#act#bck#G$~#% ~# ~#~# ~#~# ~# !#map"# ##,F3##> S$#6S$#u7S$# S$#S$#S$!G$$ ~#1~#Q7~#9~# *>~# ~#3~# ~#S,$ $ $ %b %D# #~#z#<# #<# #<###s##  ##$$#P#(Q #P#,(#P#0#i#4%#i#<2&#px#4#sv#Ǎ!##w##w# =#0# iid#~#G#~#sid#~#I& ###&#iid#~#px#4#buf#0#sid#0# ptr#~#bol#~#&#>'#˻%#2&#I& &- & &' &!['"10{{U"be04S#G'['K{Q{$l'%['s{{$l'&x'2'&14('"=~{"|U"s&R*!>&V*!>&W*+"?~p+p *B S%'{{,(S$(&#(7hx-tgx-fg0((n"Y~0||U"sX!V*+"Z~W+ .` /pa&#((P|c|,(P%'y||,(S$(&(!;&-px;(( :!()"t|u~U"ss!V)srvu!S)msgvb h*+"w~W+ *G"z~d!r)"~U"s!V)srv!S)msgb h*+"~W!)3" U"s!S)srv!S)msgb h*+"~W0 *"=U1s!S2srv!S2msg b h3+"!~W4=+"M~@QU1fdL~V5V"}5"5!P5!12tOxW2sP!S#*'}$($(6* 2ret]~P7܃8""d~7܃9__vd06 + 2sa79__v>%=+ $N+$Y+%e+ ,v+P$+&e+ #W~-nowV~'%V~&+!L~-nowK~'%K~4!,!~`ȇU1fd~5V"G2len~S2tx`2s!\3"~d3"h%'jp$($(:e/!xЇxU1t x3!~L2s!W2saX2fd~S2rv~V5'##,e/9,v/P,/R#,e/Ph$v/$/#,e/߈$v/,/P#-e+,v+P$+#1-e+Ή,v+S,+P#O-e/$v/,/P#m-e+,v+P$+#-e/.$v/,/V6- 8"~#-e+.@,v+S$+#-e+@O,v+P$+%/aw$/$/;.9__vB>6D. 3#I/V2retJ~P3=J~H6.0 3#h/V2reti~P3=i~D%['Pb,l'P#./ $/#.e+w},v+P,+P;/8"~#.e+Ï,v+S$+%/Ïُ$/$/#1/e/$v/$/#O/e+ ,v+P$+%['',l'P&/k~'j~-nowj~&/"u~-t1t~-t2t~0+H >06n0h ?0V%0dk$0#0e+x{,v+W,+P%0$1&0!x/tx@/__p&05x-tx<1' xA2' 1eA ' 1A )oA)tM1JA)u~ q1B A*Q`1A+;0Cnow+<<AG+=<A,WA,]W Cone,_A,`1 D&<4AQ0AR0AU0A VRA W-2p;'%jaY/# G0Aint@  "0<7< &wBo 60 >SG ?S) AS3 C7 DlAIF S7 U7  0IB+GQHFej DhE#fF#I  n # p #e - e# ref !#R74w xR#Iye#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$uX#( h n 2Lq40Ys7 ~Y p#$/ Lf ##  @)#!#@# P w#ۉ#X ܟ## E ) #-C% #- =$># /$ # $ # 6 $ # $# $# O$# $# z$# $#$ $#( $#, =$#0 $#4 .$>#8 $>#< w$#@ o$"L#D $#~#F $$#G b$(#H {$1#L $7#T ;$8#X [$:>#\ !$<#`d$k $T$#$#2 $>#J  C  3 b#  6  ]# # # bit>#u32 "0jZ *_ +# key ,6# H 0 wq 1A# rq 2A#v 3>#0 4>#4 50#8 6#< 7#@ 8>#Djn(8 Hv I0# J0#R K# fd L># = M0# exp N0#3 O#4 P#w3 Q# $4 R#$ ib S0 #( ob S0 #,b T0#0 U#40  S=}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#, 0#0W 0#4>#8"( #< E#@E#Ae#DJ#La #P% #T+ #X_ .t stru# lenv>#p p 0 v  Z zIe#Le# #$  # fe# be#># =>#$. 0#( req0 #, rep0 #0 si#4  ## #P# srv#3#A #.  # txn)#r >#,# #0* # …#Å##{0#_  < ]e +nk  #!e # u k a uid^&# gid_#\`# buxau  $ L fdM>#v N>#+O>#A=P #  Q #lR>##S>#T0#UU #Ve#(W #?X#%Y ##Z#W [0#b #u(c# TQum #n>#-o>#p># q# r# s>#$Q3t #(h4u #,v #0cw #4>x #8y #<?ze#@<{>#HI|e#L   >> >  >  %C f%A # b%B0 #} %? cb%C}#R%D#v %EE# ev%FE# %G#%H#   N##>#^# e#* a^#_%#B`%#az?+U,z#-#.>#/h# 5 *{ ##  "8len"90#cr":0#U";0#\% "C v"D\#[ "E#`"F#("G#2"H# !a    . !b ! l!># m_l!># u!># u_l!># v!># v_l!>#`! l!># v_l!># c!># c_l!># r!># r_l!>#}!rq!st! #D!: !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!## sl!`# | !e#8!>#@!1!#%! # !6 # req!}# rsp!}#\ uri!# !#!#nG!>#=!0#ZD 0#V 0#0#*>|HUI#v J># K>#vL># M># N# O#&Q#R># S>#$ S>#(#T0#,6T0#0dU>#4 U>#8V>#<KWe#@ X#HA=ZP#L3[P#\{=]P#lo_>#|o`#@b#b#c#_ dP#Ne#f># g>#;g>#"h># h>#h>#i>#j>#Fk># idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsA#v t#hu#ww#ww#Zx0# y1#{w#{w#|w#|w#}w#~# 0#w#~ w#w#%w#,>#&hDQp # #)#v ># +>#I>#\>#P#q!#, acle#0]e#8e#@e#H<!#P srv#\9 >#`) >#dR 7"#hU#J #>#c#>#0#>#>#K# >#& >##>#>#yЋ#1 #R>#>#S,Է###>#Ze#%8## id#Ke#d># >#d>#0#w0#\0#0# #0## 0#w#Xw#~ w##0#}0#70##N##h##` >#(#>#0#Z0# 1#w#w#w#w#w#w#  w# w# %w# >#cap># 3P# {=P# o ># o # U # A  _ # I  _ # J ~#  ~# J># R># ># ># ># q># p># ># D z# nz# ># 1># ## 4## # # ]# {## } ## ># a # ># ##   ># w!># "0# #0# $ # $ #H,% I e#!p # srv"# D >#z<# <# <#7#s7#  7#$$^#(Q ^#,(^#0w#4%w#<T px# svǵ#ȅ#ȅ# =0# iid>#G># sid>#k ͐# iid># px# buf0# sid0# ptr># bol># >' T k    p  * p  G_ p7 A=4un5< in6Px p2 u77 # L ,z{# t0|# t1|#7}#U~#># >#$>#(q!<# len0# pos0# sid0# srv# oe# src # buf+ #!be u! 0#<e#!  srv!# >#v >#"X actx # bckx #,7" act# bck#&#>#% ># >#># >#># ># # map!# !#,F"#> 2##62##u72## 2##2##2#&## >#1>#Q7>#9># *>># >#3># >#S,# # # #6 !2$x#'0U"s&2$S#max(0V$&R%d#608$ &j#>U'$#-U"p Q$Ó%j!/%;#ap 0U"srv`V"px`W#psb Q(ppb )cp S*$/%13+@%*%J%KQ+[%,q%o-%p-%l.J%#1 /s12$.f%!; /px;f%l% .%>/tv1%/tv2%% <'&R#C U"sBV#pDp)#E>W$@r)Mp P,&Sr-"&S++&.5&7h/tg/fg0!z&# YU0p S(p 1 #__pQ22#&2 #&2%t&2%u> &3 2&Q&4now<<5 2Q02R02U02 V2 W8'A6=(f2`$ G!0A@ "0<7<&iBinto60>EG?E)AE3CD^AIFS U 0IB+GQHFej #Dh#E#f#F#) )-p% )- =*~# /* # * # 6 * # *# *# O*# *# z*# *#$ *#( *#, =*j#0 *p#4 .*~#8 *~#< w*#@ o*">#D *#p#F *$v#G b*(#H {*1#L *7#T ;*8#X [*:~#\ !*<#`    ,  d*jk *T*j#*p#2 *~#3p,3$/>f ## ")#!#"#2w^C6 7~# A8~#2>q40Y^7 iY p#ڧ#t#X ܊##7 b#--}  ]# -# -# bit~#u32"0Z*_+3#key,}#I n #p # - #ref !# H 0wq 1#rq 2#v 3~#0 4~#4 50#8 6#< 7#@ 8~#D 574"w "x#I"y#`"z0# x "{0#b&"|0#r"}0#[ "~0#="0# -"0#$u"5#(E n(8$Hv $I0# $J0#R$K#fd$L~# =$M0#exp$N0#3$O%#4$P%#w3$Q%# $4$R%#$ib$St #(ob$St #,b $T0#0$U#4  Et $S= }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0W 0#4 ~#8"( ] #< 7#@ 7#A W#DJ #La #P i #T o #X+ . tstr u#len v~#  t  ] Z  zI #L # #$ #fe g!#be g!# ~# = ~#$. 0#(req t #,rep t #0si o##4 ## # #srv 3#3 3#A 3#. ##txn #r ~# !# ##0 ## w# w# E##{ 0# c  ] +nk  #! # k auid^&#gid_#\`# buxa  $ LfdM~#v N~#+O~#A=P#  Q #lR~##S~#T0#UU #V#(W#?X#%Y##Z#W [0#b #u(c# TQum#n~#-o~#p~# q# r# s~#$Q3t#(h4u#,v;#0cw;#4>x;#8y;#<?z#@<{~#HI|#L  ~ ~ ~+;~ +b+Cf+A#b+Bt # +?cb+C#R+D#v +E7#ev+F7# +G#+H#A<+]#+^#>+_#set+`#clr+a# q?+b#>+c#rem+d#clo+e#f3+f# 7+g#$r@+h'#($+i#,E+j#0u+k#4+l~#8~  ~ ~     ~~  ' Up7A=4un5 in6np2u7-#,R,N~#,O~#+,P~# ,Q~#  ,;uid,<~#gid,=~#,>~##,?~# ,@~# ,A~#,B~#8,C~#\,D~# ?,E~#$,F~#(,G#,',H#0J,I~#4,I~#8J,J~#<R,J~#@,K~#D ,K~#HA ,LU#LI ,LU#,Rn# ,S #c,T~#d N##~#P# # a ^# _%#B `%# au?+U,#-#.~#/#  2{ #D# > >d2ZD 0#V 0#0# '8len'90#cr':0#U';0#% 'Cv'D#[ 'Ew#`'Fw#('Gw#2'Hw# \&   a        . &&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#2&rq&gst&D&: &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&# | &W#8&~#@|&1&\#%&# &z #req&2#rsp&2#\uri&# &#&#nG&~#=&0#3*>|HUI3#v J~# K~#vL~# M~# N# O#&Qg!#R~# S~#$ S~#(#T0#,6T0#0dU~#4 U~#8V~#<KW#@ X#HA=Z#L3[#\{=]#lo_~#|o`#@b3#b3#c#_ d#New#f~# g~#;g~#"h~# h~#h~#i~#j~#Fk~#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v tm!#hu3#wi#wi#Zx0# y1#{i#{i#|i#|i#}i#~J# 0#i#~ i#i#%i#,~#|g!&hDQp # #)#v ~# +~#I~#\~##$#,acl#0]#8#@#H<$#Psrv3#\9 ~#`) ~#dR m%#hU#J #~#c#~#0#~#~#K# ~#& ~##~#~#y #1 #R~#~#S,&##~#Zױ#%n&#id#K#d~# ~#d~#0#w0#\0#0# J#0#J# 0#i#Xi#~ i##0#}0#70##N##h##` ~#(#~#0#Z0# 1#i#i#i#i#i#i#  i# i# %i# ~#cap~# 3# {=# o ~# o # U g!# A  U# I  U# J p#  p# J~# R~# ~# ~# ~# q~# p~# ~# D # n# ~# 1~# &# 4&# o# o# ]o# {&# } &# ~# a # ~# '#   ~# w!~# "0# #0# $)$# $)$#H9!% %I% #%! #srv%"3# ["D  ~#z <# <#  <# #s #  #$$ P#(Q P#,( P#0 i#4% i#<" px g!#sv 3# w# w# = 0# iid ~#G ~#sid ~#"  #E# iid ~#px g!#buf 0#sid 0# ptr ~#bol ~#o# >' [" " "#Es! # # # #)$L ,z{#t0|#t1|#7}m!#U~m!#~# ~#$~#($<#len0#pos0# sid0#srv3#oeg!#src#bufo #$beg!u$ 0#<#% srv%# ~#v ~#3H%Xact##bck##,m%act#bck#\&~#% ~# ~#~# ~#~# ~# 3#map$# #%#,FH%#> h&#6h&#u7h&# h&#h&# h& 3\&& ~#1~#Q7~#9~# *>~# ~#3~# ~#S,& &' 'z }'$(dow(~#h1(~#m1(~#h2(~ #m2(~#'(min(i#max(i#]$(~#$(~#'(A=(ϊ#(Њ#((i(~(}'#('$('F((ptr(str(reg(F(($,(I(Ʊ#val('#ptr((#e$(# len(~#$=(~#(( (p(i(~ll(id((a((G(L)$0(i(~#ptr(#len(~#=(~# ctx((#)0$(kw(# ()# $(f*# @(*# (0# %( ~#)~  ) L()*~ g!  ~ * `**`*;@( I(!#kw("*#arg(%*# %(&~# '$('#()*~ `* )l**%( I(#kw(*#*L)!"*(%#str($L)$/+#/`U%s. S&Z0p'/+il(@+)J+V)T+W*`+%.~+fd.~+sa.`+, $.f+-p0(@~GU%fd@~.lA }.pBg!W/sC .txnDp0}/tE.cfdF~}&\%G~}0$+0L$ 08%ݥ0$ݥ0<$0#0w%}0#g1b. &A=P~&F%Q}1, .__pnV2,v0͗304 301,50}'0(02,0(02,0(02-0)1R( 11E-6pnE1~6snE1}1-86lenW~P736png1}7MX8__vn>1-P6__ptR2--1ʜ͜(:12-F1U\(S11-h6__pR2.-1(:12._1&,(l124.w1(1(1'1J(1'0MS)1S( 19.P6pn]~7j8__vd>1.6__pQ9.-8__s1.6__pQ9.iy8__s 1/6__p&Q29/1)1P7â319W/H6msgz }9u/N6msgz }9/ţ.maxJ~P9/8__vP>1/8__vO>106pn5~6sn5~908__v@>48__v?>2+01ݥ (19E0 :j2\01&(2'1է(2*0!/t;/__p*05+t<0'%E+feDg!*05x0+tvx0<<1p$0+ctr/1+inc/0J-1-pxg!>l4 R>l7>dir~?cA*?$`*Q=3g%~U>pxg!>l4 P>l7>dir~?cA*?$`*R938__v>7Өި8__v>=3#~|U>pxg!>l4 S>l7>dir~?cA*?$`*V=14#$~U>px"g!>l4" S>l7">dir"~?cA#*?$#`*V948__v+>7֩8__v)>=4L%5~U>px3g!P>l43  >l73>dir3~?cA4*?$4`*P@$K 2UA2)4eA )4A +oA+t4bA+u~A +v~A ,[~-5BA-Q5A;0Cnow<<AG=<A,WA,]o Cone,_A,`5 2A $oAT .oA .AQ0AR0AU0A VoA W6D$<*Xfp2+o@& G0A@  "0<7< &iBinto 60 >EG ?E) AE3 C D^AIF S U  0IB+GQHFej DhE#fF# / >f p##  )p#!##  w 2>q40Y7 MY p'#p##X 2## 7 ) -@% - = ~# / #  # 6 # #  # O # # z #  #$  #(  #, = #0  #4 . ~#8  ~#< w #@ o ">#D #p#F  $#G b (#H { 1#L  7#T ; 8#X [ :~#\ ! <#` d k T # #2 ~#M  F  3 b#  9  ]# # # bit~#u32"0mZ*_+#key,9#I n #p #m - m#ref !#< H 0wq 1D#rq 2D#v 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<74w x@#Iym#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$u#(  n(8"Hv "I0# "J0#R"K#fd"L~# ="M0#exp"N0#3"O#4"P#w3"Q# $4"R#$ib"S0 #(ob"S0 #,b "T0#0"U#40 "S=}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0W 0#4~#8"( #< 7#@7#AW#DJ#La #P% #T+ #X_ .tstru#lenv~#p p 0 v  Z zI#m#L#m# #L#$ # #fe#?#be#?##~# =#~#$. #0#(req#0 #,rep#0 #0si#G!#4 ######M#srv# #3# #A # #. #W!#txn##r #~####i!#0#!# #w##w##!#{#0#_  < ]e +nk  p#!e # u k auid^&#gid_#\`# buxau  $ LfdM~#v N~#+O~#A=P#  Q #lR~##S~#T0#UU #Vm#(W #?XR#%Y ##Z#W [0#b #u(c# TQum #n~#-o~#p~# qp# re# s~#$Q3t #(h4u #,v #0cw #4>x #8y #<?zm#@<{~#HI|m#L   ~~ ~  ~  !Cf!A #b!B0 #} !?cb!C}#R!D#v !E7#ev!F7# !G#!He#  {r!_#set!`#clr!a# q?!b#>!c#rem!d#clo!e#f3!f# 7!g#$r@!h#($!i#,E!j#0u!k#4!l~#8~~ ~r~~< N##~#P# m#X a^#_%#B`%#aM?+U,#-#.~#/#   { ##< a &8len&90#cr&:0#U&;0#% &Cv&D#[ &Ew#`&Fw#(&Gw#2&Hw# "%a    . %_%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%_yD%: %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%y#sl%# | %W#8%~#@%1%#%%a# %6 #req%#rsp%#\uri%# %#%#nG%~#=%0#TZD 0#V 0#0# *>|HUI #v J~# K~#vL~# M~# N# O#&Q?#R~# S~#$ S~#(#T0#,6T0#0dU~#4 U~#8V~#<KWm#@ XL#HA=ZM#L3[M#\{=]M#lo_~#|o`#@b #b #c#_ dM#New#f~# g~#;g~#"h~# h~#h~#i~#j~#Fk~#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsD#v tE#hu #wi#wi#Zx0# y1#{i#{i#|i#|i#}i#~# 0#i#~ i#i#%i#,~#T?&hDQp # 2#)2#v ~# +~#I~#\~#M#"#,aclm#0]m#8m#@m#H<"#Psrv #\9 ~#`) ~#dR ##hU#J #~#c#~#0#~#~#K# ~#& ~##~#~#y#1 #R~#~#S, %##~#Zm#%$#id#Km#d~# ~#d~#0#w0#\0#0# #0## 0#i#Xi#~ i##0#}0#70#2#N2#2#h2##` ~#(#~#0#Z0# 1#i#i#i#i#i#i#  i# i# %i# ~#cap~# 3M# {=M# o ~# o # U ?# A  !# I  !# J p#  p# J~# R~# ~# ~# ~# q~# p~# ~# D # n# ~# 1~# %# 4%# G# G# ]G# {%# } %# ~# a # ~# /%#   ~# w!~# "0# #0# $I"# $I"#H% $I$ m#$!p #srv$" # 3 D# #~#z#<# #<# #<###s##  ##$$#P#(Q #P#,(#P#0#i#4%#i#< #px#?#sv# ##w##w# =#0# iid#~#G#~#sid#~# ##͘#!#iid#~#px#?#buf#0#sid#0# ptr#~#bol#~#G!# >'#3 #Ϊ # W! Ki!p ]!!p o!G!p7 A=4{un5< in6M!p2u7!#I"L ,z{#t0|#t1|#7}E#U~E#~# ~#$~#("<#len0#pos0# sid0#srv #oe?#src#buf+ #"be? u # 0#<m#=# srv=## ~#v ~# h#Xact!#bck!#,#act#bck#|$~#% ~# ~#~# ~#~# ~#  #map ## C##,Fh##> $#6$#u7$# $#$#$ |$% ~#1~#Q7~#9~# *>~# ~#3~# ~#S,% % /% ?%6 u% *$^*%~#kw*&#*-%#%~y~??~u%%*5I*6m#kw*7%# %?%!&'R'N~#'O~#+'P~# 'Q~# ~' ';uid'<~#gid'=~#'>~##'?~# '@~# 'A~#'B~#8'C~#\'D~# ?'E~#$'F~#('G#,''H#0J'I~#4'I~#8J'J~#<R'J~#@'K~#D 'K~#HA 'L!#LI 'L!#'R%# 'S #c'T~#"'%2@wU#cap1~R"'h&BU$\B~R%Z*%Y~U$<Wy$^W~ $&W?$&X?#errX$2X~&%Z0p&d[~l'cap[~W'res\P&u\S'tv] h'td^ V((0)c%)sc%*()g%)sg%*) )g%)sg%+)Z*dj,k**=))l%)sl%*a))p%)sp%*)dq)t%)st%*)u)t%)st%*))y%)sy%*))y%)sy%**)~%)s~%*9*8E)%)s%-gu)%)s%.w*2/&1?%+Q&~ U$<yS$^~ $&?$&?#err$2~&d~l0cap~'resp)u'tv+W0td+'val0V(Y+P)%)s%*}+)%)s%+++!,+1+P,+2Z*,k*03+@&3P414O1y42~",&?U$u$\~ #cap~W&?S&w?p*u,H])%)s%+,Z*,k*2Z*,k*5-w& jU6px-W7u 8& S8w V-%9%9s%- 5-&3~pU72?S7*2V+q-Z*Ͱ,k*+-Z*,k*+-Z*!.,k*+-Z*R_,k*2Z*,k*5z.%X~[U7%W~8Y?V8$ Z S8%[~W:err[~~8&\~~:msg]z.~+f.Z*ײ,k*2Z*/;,k* . c;. ` U:p?S2.޳1.P1.P..!L~t~+/J0(@1[0Q,f02r04@,0,0+00D`10Q,020ն10Q,02.1.S,..r0&~__vj>->__vh>?,&U@21@ 1@ !o@!t1@!u~@ '[~ 1A @(Q1B&(?ȸB)~f@);0Cnow)<<@'W&B?'~@'a~8&z%fX74/wr( G0A@  "0<7< &iB 5into 60 >EG ?E) AE3 C D^AIF S U  0IB+GQHFpj  Dh E#f F#) &-{% &- ='# /' # ' # 6 ' # '# '# O'# '# z'# '#$ '#( '#, =']#0 'c#4 .'#8 '#< w'#@ o'">#D '#p#F '$i#G b'(y#H {'1#L '7#T ;'8#X [':#\ !'<#`  d']k 'T']#'c#2 '#&{ y   3 $/ >f   # #   ) #! # # % wN+nk  #!N# ^ k2>q40Y^7 iY p#ښ#t#X ܊## 7  b# -- }  ]# -# -# bit#u32"0Z*_+3#key,}#I n #p # - #ref !# H 0wq 1#rq 2#v 3#0 4#4 50#8 6#< 7#@ 8#D574w x#Iy#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$u5#( E n(8!Hv !I0# !J0#R!K#fd!L# =!M0#exp!N0#3!O%#4!P%#w3!Q%# $4!R%#$ib!St #(ob!St #,b !T0#0!U#4Et !S=}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0W 0#4#8"(] #< 7#@7#AW#DJ#La #Pi #To #X+ .tstru#lenv#  t  ] Z zI#L# #$  #fe.!#be.!## =#$. 0#(reqt #,rept #0si6##4 ####srv#3#A #. F##txn#r #q!#X##0o## w#w# ##{0# c ] auid^1#gid_#\`&# buxa  $ LfdM#v N#+O#A=P#  Q #lR##S#T0#UU #V#(W #?X#%Y ##Z#W [0#b #u(c# TQum #n#-o#p# q# r# s#$Q3t #(h4u #,v#0cw#4>x#8y#<?z#@<{#HI|#L       )(Cf(A #b(Bt # (?cb(C#R(D#v (E7#ev(F7# (G#(H#  }<(]#(^#>(_#set(`#clr(a# q?(b#>(c#rem(d#clo(e#f3(f# 7(g#$r@(h#($(i#,E(j#0u(k#4(l#8 }p7A=4un5%in65p2u7#v)R)N#)O#+)P# )Q#  );uid)<#gid)=#)>##)?# )@# )A#)B#8)C#\)D# ?)E#$)F#()G#,')H#0J)I#4)I#8J)J#<R)J#@)K#D )K#HA )L#LI )L#)R5# )S #c)T#+ N###P# #o a^#_%#B`%#a<?+U,#-#.#/# z o{ # #+HZD 0#V 0#0# $8len$90#cr$:0#U$;0#% $Cv$D#[ $Ew#`$Fw#($Gw#2$Hw# H##   a        . ##l#݉#m_l#މ#u#߉#u_l#߉# v##v_l###l##v_l##c##c_l## r##r_l###rq#.st#D#: #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#ڟ#sl## | #W#8##@C#1###%## #z #req##rsp##\uri## ####nG##=#0#*>|HUI#v J# K#vL# M# N# O#&Q.!#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KW#@ X#HA=Z#L3[#\{=]#lo_#|o`#@b#b#c#_ d#New#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v t4!#hu#wi#wi#Zx0# y<#{i#{i#|i#|i#}i#~# 0#i#~ i#i#%i#,#C.!&hDQp # #)#v # +#I#\##n$#,acl#0]#8#@#H<$#Psrv#\9 #`) #dR 4%#hU#J #ĉ#c#Ɖ#0#ȉ#ɉ#K# ˉ#& ̉##Ή#ω#y#1 #R҉#Ӊ#S,Դ&##։#Zױ#%5&#id#K#d# #d#0#w0#\0#0# #0## 0#i#Xi#~ i##0#}0#70##N##h##` #(##0#Z0# <#i#i#i#i#i#i#  i# i# %i# #cap# 3# {=# o # o # U .!# A  # I  # J p#  p# J# R# # # # q# p# # D # n# # 1# &# 4&# 6# 6# ]6# {&# } &# # a # # &#   # w!# "0# #0# $## $##Hq!% "I" #"! #srv""# ""D #zG# G# G##s#  #$$P#(Q P#,(P#0i#4%i#<"px.!#sv#w#w# =0# iidʉ#Gʉ#sidʉ#" # #iidЉ#px.!#buf0#sid0# ptrԉ#bolՉ#6#>'""Ι"ְ" F#E :!X# L#o# ^##L ,z{#t0|#t1|#7}4!#U~4!## #$#(n$G#len0#pos0# sid0#srv#oe.!#src#bufo #$be.!u$ 0#<#$ srv$# #v #%Xactu##bcku##,4%act#bck##&#% # ## ## # #map$# $#,F%#> /&#6/&#u7/&# /&#/&#/&#&& ى#1ډ#Q7ۉ#9܉# *>݉# މ#3߉# #S,& & & &z G!'')U"$ ( Q#('@ rU" ? R$$ A S%errB&(vü'+(()6(*(A(~G+R(V+](+h(+s((,~(_,(,(,(P,(W-(-(-(-(&(PZ'(.A((/$  0fd.('_//^1uid^11gid^/\^&2'`(2'a(2A=b%0retd2 d3'3(3(3X' (4(!T1fdS#z)'RU" Q P$$ S S&z)`')&)ھD+)~(,)~,)V,)P5) )6$  4)D'//2A=%2 щ0retщ7+(gZU8fdg%lh ~9si 9tj%cfdk~$\%l~:$-:L$*:8%(:t'&;+$A=t~$F%u~;*%__pS**+W])+(()+(X,+W** ,',;+%__sP;&+%__sP;>+%__pR*U+%,'2,;m+%__pR*+%,sv'2,*+(5\'(&>,'O,'X,*+b,'o,<=j+. ,!0t>0__p.%,51t4>,$/1buf.t .b,7h1tg1fg04y,1tǐ7.:(7`U8s6 ",6Q$<8.%arg9W?,=R%=sR%?-=S%=sS%*=-.47'.+.P'.*`-.^a'.+.P'.?-x=`%=s`%?-=f%=sf%?-=j%=sj%*..<H'/&/<H'0/'4#09P+40P+?0V*^4#0Ul+40P+?0V�x+40P+?0V44$1buft 44(t1bufst .4"u1t1t1t2t45'c1bufbt />b02&d045&1buft .75"1t.R5 ~1t}.m5 v1tu45]/|\5.51t.51t45'M1bLt AR(`rUB%K55 >BU%L66 ~B%M6B2&66pB &66B (oB(tc6)B(uB (vB )[ 6C B*Q6B+;0Dnow+EG?E)AE3CD^AIFS U 0IB+GQHFpj 'Dh'E#f'F#27 2J|2G# p ?2J{) --K% -- =.# /. # . # 6 . # .# .# O.# .# z.# .#$ .#( .#, =.#0 .#4 ..#8 .#< w.#@ o.">#D .#p#F .$#G b.(#H {.1#L .7#T ;.8#X [.:#\ !.<#`7W Qnzd.k .T.#.#2 .#  z  3tm,wx#y#z#{# |#}#~### f#$ZQ#($/>f ##  )#!## & wKInK#pK#&z - &#ref!K#74&w &xb#I&y&#`&z0# x &{0#b&&|0#r&}0#[ &~0#=&0# -&0#$u&#( # F bF# VV #  ]+# V# V# bit#u32"0Z*_+\#key,#U H0wq1#rq2#v 3#04#450#86k#< 7#@8#DeeeU N###P# &#qN##z2>q40Y7  EY p#ڛ##X *## 7 h n(8 Hv I0# J0#R K#fd L# = M0#exp N0#3 Oz #4 Pz #w3 Qz # $4 Rz #$ib S #(ob S #,b T0#0 U#4t t h   S= }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0W 0#4 #8"( #< 7#@ 7#A W#DJ t #La t #P #T #X  . tstr u#len v#     Z  zI &#L &# e#$ N#fe "#be "# # = #$. 0#(req #,rep #0si $#4 ## # E#srv #3 #A #. %#txn #r # 3## %#0 1%# w# w# $#{ 0#  ] +n!k ! #!! #  k A auid^1#gid_#\`&#T buxa [$ LfdM#v N#+O#A=P#  QH#lR##S#T0#UUN#V&#(Wd#?Xk#%Yj##Z#W [0#bA #u(c#H TQump#n#-o#p# q# r# s#$Q3td#(h4ud#,v#0cw#4>x#8y#<?z&#@<{#HI|&#L[T dT  H /Cf/Ad#b/B # /?cb/C#R/D#v /E7#ev/F7# /G&#/H# &  h Uh###1 U##7#n(S, %&#'#Y(#4)# =*#-+h#,#U-(# %U%#u%#Z%#len% # %!#C%"#.p 7A= 4un 5 in 6Ep 2u 7# 0R0N#0O#+0P# 0Q# y 0;uid0<#gid0=#0>##0?# 0@# 0A#0B#80C#\0D# ?0E#$0F#(0G#,'0H#0J0I#40I#8J0J#<R0J#@0K#D 0K#HA 0L#LI 0L#0R# 0ST #c0T#  #a#^##_%#B#`%##ay#e #j#h##i##j7?"+U",7#"-=#".#"/Q# C q{ K##}}qZD 0#V 0#0# *8len*90#cr*:0#U*;0#P% *Cv*DP#[ *Ew#`*Fw#(*Gw#2*Hw#  )!!!a! ! !!!! ! . )V )l)݉#m_l)މ#u)߉#u_l)߉# v)#v_l)# T)l)#v_l)#c)#c_l)# r)#r_l)#q)rq)st)D): )0#sol)#eol)#som)0# col)0#sov)0#eoh)0#cap)#sl)T# | )W#8)#@)1)#%)# ) #req)q#rsp)q#\uri)# )#)#nG)#=)0#!-) ,)Q#idx)#val)# )# *>|HUI#v J# K#vL# M# N# O#&Q"#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KW&#@ Xe#HA=ZE#L3[E#\{=]E#lo_#|o`#@b#b#c#_ dE#New#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v t"#hu#wi#wi#Zx0# y<#{i#{i#|i#|i#}i#~# 0#i#~ i#i#%i#,#"&hDQpN# *#)*#v # +#I#\#E#0&#,acl&#0]&#8&#@&#H<N&#Psrv#\9 #`) #dR &#hU#J #ĉ#c#Ɖ#0#ȉ#ɉ#K# ˉ#& ̉##Ή#ω#yH#1 #R҉#Ӊ#S,(##։#Z&#%'#id#K&#d# #d#0#w0#\0#0# #0## 0#i#Xi#~ i##0#}0#70#*#N*#*#h*##` #(##0#Z0# <#i#i#i#i#i#i#  i# i# %i# #cap# 3E# {=E# o # o # U "# A  # I  # J p#  p# J# R# # # # q# p# # D 7# n7# # 1# # 4# # # ]# {p(# } p(# # a # # (#   # w!# "0# #0# $%# $%#H+3#% (I( &#(! #srv("# #D  #z G# G#  G# #s #  #$$ P#(Q P#,( P#0 i#4% i#< [$ px "#sv Ǽ# w# w# = 0# iid ʉ#G ʉ#sid ʉ# r$  Q# $ iid Љ#px "#buf 0#sid 0# ptr ԉ#bol Չ#$ >' # [$ r$ % "% %1% t  %%L ,z{+#t0|+#t1|+#7}"#U~"## #$#(0&G#len0#pos0# sid0#srv#oe"#src#buf #N&be"u s& 0#<&# & srv&# #v # &Xact7%#bck7%#, &act+#bck+# '#% # ## ## # #maps&# &#,F&#> '#6'#u7'# '#'#'' p( ى#1ډ#Q7ۉ#9܉# *>݉# މ#3߉# # ( ( "(-#6+"#u,(' I(&# B)E)#be-(# E){A) I+?&# ;+@&#pol+A# +B0# ,+C#()O(0 I1&# B2E)# G3# 4# %5# 6# =70# 8# 9#$>*$+dow+#h1+#m1+#h2+ #m2+# *+min+i#max+i#]$+ˉ#$+̉# *+A=+*#+*#*+i+ȉ+>*#+х*$+)++ptr+str+reg++n+$,+I+&#val+Ӫ*#ptr+*#e$+h# len+ډ#$=+ۉ#(+ +p+i+ll+id++a++G +  ,$0+i+#ptr+#len+#=+# ctx+n+#t,0$+kw+Q# +,# $+'-# @+B-# +0# %+ #,\,j +t,," ,!-,!-;@+ I+!&#kw+"-#arg+%-# %+&# '$+'&#+,B-!-,--s-%+ I+&#kw+s-# - ,$"-+%%str+$ ,-* 1 #len #  -# -W  -&X.@/ԀU'iՉQ'tmpQ'msg׉S(B.)__s*)__s+. 24U,b~ ,msg~.W-%.p- QS.>P/lenq+C/%+@U,b R,msg.S-%.V- Q,lenW.>P+/1=U,hdrQ,endQV-uQ,lenW0valQR+/?-Q@U,sQP,eQS.+V. ,Q+0.%U-uQ,len ,solQW,idx.R,ctx00eolQV0sovQS..p1121\,200#>3040@G3150/<6I;.5 1l016I0.+d1-0[U-uQS,solQ ,idx.,ctx0727)$`9U,t" S,si"t R,err#- )# -nG#W,msg#2V212kn8*2Q2123*24623C22 962/~:buf} 9O2$:buf +2-372@U,s6 S-26Q ;21EU,strDQp,lenD,l0mF7P0hG2S2 -;/33*^U,txn]/3P0ptr_Q0end_S<3~0mU,s W,sit  0txn/3V0rdr h./Q0lenS43m332338 4Q344&4F_33493-(:s'9 4p$0:ctr/ 4:inc/09?4%!:ctr 4<40pU,s V,sit S.b P<6,U,s V0pn0fe"~0be"~="0txn/3W.~.O~0err~0uriP0hR.|~0tm~.`+6.<~0hdrS25.6)/8<6~8H6P25_63p63{6256 C3636* C>6(6/__vS>*/__vR> .6?T6@nowT6@tmY6 <56):tv1և6:tv2և66 GA6JP@tv1I6@tv2I6/retKP<70sU,somq,idxq. ,capr- r0eoltp0soltl0coltV0sovtW..uh0hvS0lenwd2703027031B0__pQ+8z,Q8U,msg.V--QW-v 0S,ptrQR,endQQ- .-m*8 1+i1m)1]11!21-/I1.1+1)0+9-6Q@ U,msg3.S--3Q -v 40P,ptr4QR,end4QQ- .5W-m*58 1+; 1m)s1.Q@1;+Z12g1-r1/{1/\11i1,tn;9;)F6IE.:lenE:crE9;$"6I!.C)e$1z 0U,sy S,reqy V0txn{ /3W2N>t>J]8>P8>R46g3636BE6P5>k6j:nowj+?0  U,s ,req  0msg .W. + PT.b& i@0ctx X1r- (t?.. 0PB/c B0hex 0R* . P2?t>:N3>8>P2?t=NT3=4?Zv8?R8?P4@pt8@P3$@5@ #W:nowV6%V50@!L:nowK6%K<@R-'VU,t& P,rtr& Q0txn(/3p0p1)l0p2)V..+V.,+S.j.+h..,W2@030B.%.8PP0val9P 1s/ 6DM.. S0msg .d.;3 "`B=j/ "D^M.. S., V.j. \.. X.e) T. P0val P.%. PP40302uM=693=4=9<3=2MO3O3'O2M6+3636*+E6P(M0lenZ S(CN0eol# V0sol# W2/N0 3040")312ZN=3=2qN=3=2N=3=2N=3=2N=n q 3=2N=q t 3=2N=!!3=2N=!!3=4t=!!3=93O+:buf 6[ +wU/0";U,s ,req  ..W0txn/30msg..;3"~130_ +1*m $1+A *D;P.B+E)W.$,wUW=j/-"DPP0ret2RB0rdr9 .*:QRDSP0retP2P}U%%3U43%%8 4R34DQ..S.,W.j.~..~.e)~.P0valP.%.P~40 &"&30DvQ0.$UWDHQH0retR4}U(b(3U43&(2(8 4R342Q}U(+)3U43((8 4R342QO**3O3'O2Q2**8*2R2Qt=*+3=2R?+ +8?Q8?P21R@,+4+8@P3$@2OR@@+M+8@P3$@DuRh./SQV.+TS2R}UO..3U43V.b.8 4R34DR0qs[PDR0lenPVDR0lenS0pnKVDS0lenV0pnKWD7S0__pQ(SS422.0SDS.P.,S4q; 3433~;8;P8;R(S4440eol,S0sol,V2S0Z4e43040{4431DT0.BE)VBP0retPDATh0lenS0pnU2_Tt> 6;63>8>P2vT&47#73342T&4z773342T&4V8s83342Tt=883=2T?888?R8?P4@888@P3$@2 U&489334DIU. i0ctx 4t=993=DcU0ctx 4t=::3=K)9U% N:be M"( U -; V1; <U- \S-\C,W-P/j/len.1P;V`2<T<U,px",l4  ,l7R,dir-cA,-$!-Q.1P/txn/3;V0`<<U-$!-Q-\C,S=0;"W,<=U- \S-\C,V-P/j;WZ. =y=U,px",l4  ,l7P,dir-cA,-$!-V/txn/30ptrR0lenQ;TXh+==U,px",l4  ,l7P,dir-cA,-$!-V/txn/30ptrR0lenQ;Y*=E>U,px",l4  ,l7R,dir-cA,-$!-V/txn/3/ptr0lenP4Y>3>8)YQ82YS*>3>E=YR5GY0:sQ:len)i0;Y,+P>>U,px)",l4)  ,l7)R,dir)-cA*,-$*!-Q/txn,/3;?Z.C>?U,pxA"P,l4A V,l7AR,dirA-cAB,-$B!-S/txnD/3;Z:2c??U,pxa"P,l4a S,l7aR,dira-cAb,-$b!-V/txnd/3*T?_?/__vr>;f[2?;@U,px"P,l4 R,l7P,sol -cA,W-$!-S/txn/30idx.Q0ctx0V;[*@@@U,px"V,l4 S,l7Q,dir-cA,R-$!-P/txn/3;Z\A*@@U,px"V,l4 S,l7Q,dir-cA,R-$!-P/txn/3;]!0@/AU,px"P,l4 R,l7P,sol -cA,W-$!-/txn/30idx.V0ctxX0cntS;z]-0AuAU,px"V,l4 S,l7Q,dir-cA,R-$!-P/txn/3;]W/AAU,px"V,l4 S,l7Q,dir-cA,R-$!-P/txn/3;^+AiBU,px"P,l4 R,l7P,sol -cA,W-$!-V/txn/30idx.Q0ctx0S;_2pBBU,px"V,l4 S,l7Q,dir-cA,R-$!-P/txn/3;~_x+,BBU,px*"V,l4* S,l7*Q,dir*-cA+,R-$+!-P/txn-/3;`/>CdCU,px<",l4<  ,l7<P,dir<-cA=,-$=!-S/txn?/30ptr@P0end@VF*pCCUG,K7`=` >GU,LO`U` ~G,MO`G2-t`G -t`GGG/t`G/uG 0[ `H GQ`G;0InowLG?L)AL3CDeAIFS U 7-IB+GQHFpj !Dh!E#f!F#) %-{% %- =&%# /& # & # 6 & # &# &# O&# &# z&# &#$ &#( &#, =&]#0 &c#4 .&%#8 &%#< w&#@ o&"E#D &#w#F &$i#G b&(y#H {&1#L &7#T ;&8#X [&:%#\ !&<#`  d&]k &T&]#&c#2 &%#&{ y   3% %$/Ef ##   )#!# # 0 w{Wڥ#ۺ#X ##+nWk  #! #2Eq47Y7 Y p# >    b # .. ~   ] #  .#  .# bit %#u32 "7Z *_ +4#key ,~#I n #p # - #ref !# H 0wq 1#rq 2#v 3%#0 4%#4 57#8 6#< 7#@ 8%#D674 w x#I y#` z7# x {7#b& |7#r }7#[ ~7#= 7# - 7#$u 6#( F n(8Hv I7# J7#RK#fdL%# =M7#expN7#3O&#4P&#w3Q&# $4R&#$ibSu #(obSu #,b T7#0U#4  Fu S=}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#, 7#0W 7#4%#8"(^ #< >#@>#A^#DJ #La  #P #T #X, .tstru#lenv%#  u  ^ Z zI #L # #$ #fe n#be n# %# = %#$. 7#(req u #,rep u #0si J%#4 ## # 6#srv  #3  #A  #. Z%#txn #r %# ## l%#0 %# ~# ~# %#{ 7#  $ %#J$!%#a $"%#U$# # d ] k auid^1#gid_#\`&# buxa  $ LfdM%#v N%#+O%#A=P#  Q #lR%##S%#T7#UU#V#(W&#?X#%Y##Z#W [7#b #u(c#  TQum,#n%#-o%#p%# q# r# s%#$Q3t&#(h4u&#,vL#0cwL#4>xL#8yL#<?z#@<{%#HI|#L  &%% < L% <s'Cf'A&#b'Bu # '?cb'C#R'D#v 'E>#ev'F># 'G0#'H# R <']#'^#>'_#set'`#clr'a# q?'b#>'c#rem'd#clo'e#f3'f# 7'g#$r@'h-#($'i#,E'j#0u'k#4'l%#8%%%% -!r #8len#97#cr#:7#U#;7#% #Cv#D#[ #E~#`#F~#(#G~#2#H~# 3"a    . "p"l"%#m_l"%#u"%#u_l"%# v"%#v_l"%#"l"%#v_l"%#c"%#c_l"%# r"%#r_l"%#"rq"st"pD": "7#sol"#eol"#som"7# col"7#sov"7#eoh"7#cap"ڊ#sl"# | "^#8"%#@."1"#%"r# "{ #req"#rsp"#\uri"# "#"#nG"%#="7# N##%#W# #. a^#_,#B`,#a?+U,#-#.%#/# ! O{ #a#[[OGt&hDp# #)#v %# +%#I%#\%#6# !#,acl#0]#8#@#H<+!#Psrv #\9 %#`) %#dR !#hU#J #%#c#%#7#%#%#K# %#& %##%#%#y&#1 #R%#%#S,S###%#Zײ#%"#id#K#d%# %#d%#7#w7#\7#7# #7## 7#p#Xp#~ p##7#}7#77##N##h##` %#(#%#7#Z7# <#p#p#p#p#p#p#  p# p# %p# %#cap%# 36# {=6# o %# o # U n# A  # I  # J w#  w# J%# R%# %# %# %# q%# p%# %# D # n# %# 1%# _## 4_## # # ]# {e## } e## %# a # %# u##   %# w!%# "7# #7# $ # $ #HZD 7#V 7#7#p7A=4un5{in66p2u7#Q% I #! #srv" #  *>|"UI #v J%# K%#vL%# M%# N# O#&Qn#R%# S%#$ S%#(#T7#,6T7#0dU%#4 U%#8V%#<KW#@ X#HA=Z6#L3[6#\{=]6#lo_%#|o`#@b #b #c#_ d6#Ne~#f%# g%#;g%#"h%# h%#h%#i%#j%#Fk%#idm#n7#L n7#o7# p7#Oq7#r7#Vr7#gs#v t #hu #wp#wp#Zx7# y<#{p#{p#|p#|p#}p#~# 7#p#~ p#p#%p#,%#Q L ,z{#t0|#t1|#7} #U~ #%# %#$%#( !G#len7#pos7# sid7#srv #oen#src#buf #+!benuP! 7#<#! srv!# %#v %# !Xact #bck #,!act#bck#"%#% %# %#%# %#%# %#  #mapP!# !#,F!#> "#6"#u7"# "#"#" "M# %#1%#Q7%#9%# *>%# %#3%# %# S,M# Y# u# #{ 6$D  %#z G# G#  G# #s #  #$$ W#(Q W#,( W#0 p#4% p#<$ px n#sv  # ~# ~# = 7# iid %#G %#sid %#$  # % iid %#px n#buf 7#sid 7# ptr %#bol %#J% >' 6$ έ$ $ Z%F l% `%%  r%%+R+N%#+O%#++P%# +Q%# ,' +;uid+<%#gid+=%#+>%##+?%# +@%# +A%#+B%#8+C%#\+D%# ?+E%#$+F%#(+G#,'+H#0J+I%#4+I%#8J+J%#<R+J%#@+K%#D +K%#HA +L#LI +L#+R%# +S #c+T%#!'3L%CCU"w4L%S"3L'Q"74L%R"=4L'V#lenL,W"=LWP$LS%(E4%C,FU&si p&bu S',4%l'd%h(ret%Q(max%d)@(340FFU&si3 S!)E3%F'MU#fd%*si p*bu V*ret%Q*max%l$d%h$n4%d$a3%`+!G+3zK+V"G,*))0GG-)-)./)W/)Q0)0)/*S1B)'3%S,`)*HH2*S-(*,)2*HI2C*R2N*P3Z*HI2k*P-v*4II(fwd@%R5*3h%6bgu 6sig 7fdi%7retj%7maxj%8j%8dk%52*7h6tg6fg75Z* #W%6nowV%9%V%5*!L%6nowK%9%K%)*4 0MMU&si  S:+\4%MPU&fd%(si W(bu V'd%p+!N+V"N+3N,<+*'N*N2*S-(*,S++NN-+,+2*NO2C*S2N*P3Z*OO2k*P-v*,+*POoO2*S-(*32*OO2C*Q2N*P3Z*OO2k*P-v*5+V3D%9C%),3OPhRU&siN V(ibPu W(obQu S(fdR%p,,2*QQ2C*R2N*P3Z*QQ2k*P-v*,,2*QQ2C*R2N*P3Z*QQ2k*P-v*32*QR2C*R2N*P3Z*QR2k*P-v*)*-k3pRRU&si R(ibu P).4RTU&si V(obu S'd%P+V" S,-+SS-+,-2*SS2C*W2N*P3Z*SS2k*P-v*,-*SS2*S-(*32*pTT2C*R2N*P3Z*TT2k*P-v*;2%).p; %).; 'o;'tV.s;'u% z.< ;(Qi.;);7;Z*%;Q7;R7;U7; V; W.;+W%+9/YU|4 G0A@  "0<7< &iBinto 60 >EG ?E) AE3 C D^AIF S U  0) -% -=~#/ # #6  #  ##O# #z# #$#(#,=#0#4.~#8~#<w#@o">#D #p#F$ #Gb(#H{1#L7#T;8#X[:~#\ !<#`  dk  T# # 2 ~#   / 3HFcj D hE# fF#IB+GQI n #p #  - #ref !#x74w x# Iy# `z0# x {0# b&|0# r}0# [ ~0# =0# -0#$ ux#(   b#    ]### bit~#u32"0?Z* _+#key, # H0wq1#rq2# v 3~#0 4~#4 50#8 6#< 7#@ 8~#D?)  N# # ~# P# #] N]# ]# { # #)2>q40Y7 Y  p# $/ >*f   # *# : q ) # ! #  q#  w # ۺ# X # # 7 n(8 H v I0#  J0# R K#fd L~# = M0#exp N0# 3 O# 4 P# w3 Q# $4 R#$ib S #(ob S #, b T0#0  U#4  S =}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 W 0#4 ~#8 "( #< 7#@ 7#A W#D J#L a #P  #T  #X4 .tstru#lenv~#E E  K  Z z I!# L!# !# $ !#fe!#be!# !~# =!~#$ . !0#(req! #,rep! #0si!"#4 !:# #!:# !#srv!# 3!# A !# . !"#txn!=# r !~# !@ # !'"# 0!>"#  !w# !w# !!# {!0#4   ]: +n k  # !: # J k} auid ^y#gid _c# \ `n# bux aJ  $ Lfd M~# v N~# + O~# A= P:# Q# l R~# # S~#  T0# U U#  V# ( W# ? X# % Y# # Z# W [0#  b} # u( c# T Q u m#  n~# - o~#  p~# q# r#  s~#$ Q3 t#( h4 u#,  v#0 c w#4 > x#8  y#< ? z#@ < {~#H I |#L  ~~~  ~CfA#bB #R ?cbCR# RD# v E7#evF7# Gb# H# b p7A=4un5 in6p2u7h#'R 'N~# 'O~# +'P~# 'Q~# L ';uid'<~#gid'=~# '>~# #'?~# '@~# 'A~# 'B~# 8'C~# \'D~# ?'E~#$ 'F~#( 'G#, ''H#0 J'I~#4 'I~#8 J'J~#< R'J~#@ 'K~#D 'K~#H A 'L#L I 'L# 'R# 'S # c'T~# a ^# _%# B`%#aL?+ U,# -# .~# /#   $8len$90#cr$:0#U$;0#p% $Cv$Dp# [ $Ew# `$Fw# ($Gw# 2$Hw#  #!!!a! ! !!!! ! . #v#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~#t#l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#7D# : #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#7#sl#t# | #W#8 #~#@# 1## %## # #req##rsp##\uri## ## ## nG#~# =#0#ZD  0# V 0# 0#*>|H UI# v J~#  K~# vL~# M~# N#  O# &Q# R~# S~#$ S~#( #T0#, 6T0#0 dU~#4  U~#8 V~#< KW#@ X#H A=Z#L 3[#\ {=]#l o_~#| o`# @b# b# c# _ d# New# f~# g~# ;g~# "h~# h~# h~# i~# j~# Fk~#idm# n0# L n0# o0# p0# Oq0# r0# Vr0# gs# v t # hu# wi# wi# Zx0# y/# {i# {i# |i# |i# }i# ~# 0# i# ~ i# i# %i# ,~#&hDQ p# # )# v ~# +~# I~# \~# # D##,acl#0 ]#8 #@ #H <b##Psrv#\ 9 ~#` ) ~#d R  $#h U# J # ~# c# ~# 0# ~# ~# K# ~# & ~# # ~# ~# yc# 1 # R~# ~# S,Ԋ%# # ~# Z׋# % %#id# K# d~#  ~# d~# 0# w0# \0# 0# # 0# # 0# i# Xi# ~ i# #0# }0# 70# # N# # h# # ` ~# (# ~# 0# Z0# /# i# i# i# i# i# i# i#i#%i#~#cap~#3#{=#o ~#o #U #A  #I  #J p# p#J~#R~#~# ~# ~#q~#p~#~#D #n#~#1~#%#4%#]#]#]]#{%#} %#~#a #~#%#  ~#w!~#"0# #0#$"#$"#H@ % " I" # "!E #srv""#  D! !~# z!:# !:# !:# !# s!# !#$ $!P#( Q !P#, (!P#0 !i#4 %!i#<h!!px!#sv!# !w# !w# =!0# iid!~# G!~#sid!~#! ! !Ͷ#!!iid!~#px!#buf!0#sid!0# ptr!~#bol!~#"!>'! !h!!! "  '"E ">"E -"G"L ,z {#t0|#t1|# 7} # U~ # ~# ~#$ ~#(D# :#len0#pos0# sid0#srv#oe#src:#buf #b#beu#  0# <## srv## ~# v ~##XactK"#bckK"#, $act#bck#$ ~# % ~# ~# ~# ~# ~# ~# #map## ##, F## > %# 6%# u7%# %# %#%$%  ~# 1~# Q7~# 9~# *>~# ~# 3~# ~#S,% % % % "`&5W~UUU#4X~$.&`&U_U%q&&%q&'&(({&R)&6U=U*&$L&&lUqU+&P*&)&UU*&,&!-t.-__p,&5/t,&!L~/nowK~0%K~1&0 "W'4#~UVU#4$~24%~3s&S3p'W4VV#'5/~V#4/~p"%(4gWJXU5tf3php#4i%(l#4jS#(jW3ik~h$'+(`WpW+<(P*G($'&WW+&P*&6(WX-lent~&@2j}c,S(k~0j~/nowj~"(C~PXvXU74P74P252 54VXjX2%2s%8(XXU75S8)4XYU3pS$)) YYY*)$Y)) Y%Y*)))Y%Y*)))YY* *)*%YYY*,*)6*,YYY*G*)),Y8Y+ *P)Q*YY{Y+^*Q,)"/t,) ~/t},) v/tu1*]0|\*,6*/t,Q*/t1h*/t92u*9 u*9&u*:]P:4H:  ~T9t*9u~ *; 9%Q*9&;0EG?E)AE3CD^AIFS U 0IB+GQHFpj !Dh!E#f!F#) (-{% (- =)# /) # ) # 6 ) # )# )# O)# )# z)# )#$ )#( )#, =)#0 )#4 .)#8 )#< w)#@ o)">#D )#p#F )$#G b)(#H {)1#L )7#T ;)8#X [):#\ !)<#` 7 6 B  d)k )T)#)#2 )#I{B3$/>f ## 8)#!#8#HwtC6 7# A8#2>q40Yt7 Y p#ڽ#ۊ#X ܠ##73 b3#CC  ]# C# C# bit#u32"0Z*_+I#key,#In#p# - #ref!# H0wq1#rq2#v 3#04#450#86#< 7#@8#D K74w x*#Iy#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$uK#([ )n(8#Hv #I0# #J0#R#K#fd#L# =#M0#exp#N0#3#O;#4#P;#w3#Q;# $4#R;#$ib#S #(ob#S #,b #T0#0#U#4 5 5[) #S= }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0W 0#4 #8"( s #< 7#@ 7#A W#DJ 5#La 5#P  #T #XA . tstr u#len v#   s Z  zI"#L"# "#$ "#fe"!#be"!#"# ="#$. "0#(req" #,rep" #0si"##4 "##"#"#srv"#3"#A "#. "##txn"#r "#" "#"##0"$# "w#"w#"ץ##{"0# y  ] +nk  #! # k auid ^1#gid _#\ `&# bux a  $ Lfd M#v N#+ O#A= P#  Q #l R## S# T0#U U# V#( W%#? X#% Y+## Z#W [0# b #u( c#  T Qu m1# n#- o# p# q# r#  s#$Q3 t%#(h4 u%#, vQ#0c wQ#4> xQ#8 yQ#<? z#@< {#HI |#L  % AQ Ax+Cf+A%#b+B # +?cb+C#R+D#v +E7#ev+F7# +G#+H#W<+]#+^#>+_#set+`#clr+a# q?+b#>+c#rem+d#clo+e#f3+f# 7+g+#$r@+h=#($+i+#,E+j+#0u+k#4+l#8       +  = 1kp7A=4un5 in6p2u7C#.R.N#.O#+.P# .Q# ' .;uid.<#gid.=#.>##.?# .@# .A#.B#8.C#\.D# ?.E#$.F#(.G#,'.H#0J.I#4.I#8J.J#<R.J#@.K#D .K#HA .Lk#LI .Lk#.R# .S #c.T#z N###P# #' a^#_%#B`%#a?+U,#-#.#/#  H{ #Z# T TzHZD 0#V 0#0# &8len&90#cr&:0#U&;0#'% &Cv&D'#[ &Ew#`&Fw#(&Gw#2&Hw# r%   a        . %-%l%݉#m_l%މ#u%߉#u_l%߉# v%#v_l%#+%l%#v_l%#c%#c_l%# r%#r_l%#H%rq%}st%D%: %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%#sl%+# | %W#8%#@%1%r#%%# % #req%H#rsp%H#\uri%# %#%#nG%#=%0#!-% ,%#idx%#val%# %# *>| HU I#v J# K#v L#  M# N# O#& Q!# R#  S#$ S#(# T0#,6 T0#0d U#4 U#8 V#<K W#@ X#HA= Z#L3 [#\{= ]#lo _#|o `#@ b# b# c#_ d#N ew# f# g#; g#" h# h# h# i# j#F k#id m# n0#L n0# o0#  p0#O q0# r0#V r0#g s#v t!#h u# wi# wi#Z x0# y<# {i# {i# |i# |i# }i# ~`# 0# i#~ i# i#% i#, #!&hD Qp # #) #v # + #I #\ # # %#,acl #0] #8 #@ #H< %%#Psrv #\9 #`) #dR %#hU #J # ĉ#c # Ɖ# 0# ȉ# ɉ#K # ˉ#& ̉# # Ή# ω#y #1 #R ҉# Ӊ#S, M'# # ։#Z #% &#id #K #d # #d # 0#w 0#\ 0# 0# `# 0# `# 0# i#X i#~ i## 0#} 0#7 0# #N # #h # #` #( # # 0#Z 0# <# i# i# i# i# i# i#  i#  i# % i#  #cap # 3 # {= # o # o # U !# A k# I k# J p#  p# J # R #  # # # q # p #  # D # n #  # 1 #  Y'# 4 Y'#  #  # ] # { _'# } _'#  # a #  #  o'#  # w !#  "0# #0#  $$#  $$#H "% $I$ #$! #srv$"# "D" "#z"G# "G# "G#"#s"#  "#$$"P#(Q "P#,("P#0"i#4%"i#<2#"px"!#sv"Ǔ#"w#"w# ="0# iid"ʉ#G"ʉ#sid"ʉ#I# ""##"iid"Љ#px"!#buf"0#sid"0# ptr"ԉ#bol"Չ##">'"˻""2#"I##[! # # $ 5#$L , z {#t0 |#t1 |#7 }!#U ~!# #  #$ #(%  G#len 0#pos 0# sid 0#srv #oe !#src #buf #%% be !u J%  0#< #}% srv }%# #v #%X act $#bck $#,% act #bck #&  #% # # #  # # # #map J%#  %#,F %#> &#6 &#u7 &#  &# &# & &G'  ى#1 ډ#Q7 ۉ#9 ܉# *> ݉# މ#3 ߉# #S,G' S'o' ' '$'dow'#h1'#m1'#h2' #m2'#$('min'i#max'i#]$'ˉ#$'̉#I('A='Ϡ#'Р#|('i'ȉ''#'$($''('ptr'str'reg'צ( )$,'I'#val'I(#ptr'|(#e$'0# len'ډ#$='ۉ#(D) 'p'i'll'id'D)a'K)G[))$0'i'#ptr'#len'#='# ctx' )#*0$'kw'# '3*# $'*# @'*# '0# %' #-* $ -* +(*b* !  b* *h**;@' I'!#kw'"7+#arg'%!+# %'&# '$''#[)9** * -**+%' I'#kw'+#!+)!"7+'%#str'$)$+9YZU%px!&op&totW'8V&curQ'6l(+X&maxȉh)x*v͉+, :LZL[U%pxK!Q&srvMR,,Z[-#,-.,.:,5:/v 9/n59+],_5hP[[U%pxg!R+,N6z[\U%srvyS&p{!V08[,,[[-#,-.,+-W7 \\U%srvS&p!V08G\,,9\G\-#,-.,$-5\]U%p!W&srvV'9S&actp&bckl1\]&w`1\]2t3.7*]_U4srv)S5p+!W5grp,.P68W^66T^7-,]]-#,-.,7.,] ^-#,-.,(+.8L DR7G.,]^o^-#,-.,7s..^^-.,.^^9.P,.^_-.$:.q9;;s:<.]/|\.:.7;s3i/7D__U4sCV5pE!R5grpF.W77/,1_@_-#,-.,7N/.@_J_-.,i/o_t_9w/S-/:/7= !;s>05 _aU4p !V5srvS?G97/,(a=a-#,-.,,i/=apa9w/W-/307a(bU4sQ2p!5grp.R7b00aa-0)@0P7y00aa-0,0ab-0)@0P:0<6z;sy2grp{.:05j;si:08p;so2grpq.31i6d0bRcU4srvcS5pe!V5grpf.W68Wb663c7p1,SbWb-#,-.,71,pbb-#,-.,)8L P328`ceU4srvW?6?155p!p5grp.l72,cc-#,-.,722,cc-#,-.,7^2.kdzd-.,.kdzd9.PA20exe86Q?572.ee-.,.ee9.P72.ee-.,.ee9.V,i/ee9w/S-/3\36]eSfU4s\V7H3\3f!f-j3,.f!f9.S,u3!fLf-3:u37J;sI:3q8S;sR34p7k`fGgU4srvjS5pl!V68f66f73,{ff-#,-.,74,ff-#,-.,('48L R7C4,fg-#,-.,7o4\3&g8g-j3,.&g8g9.P,48gGg-4:48D;sC3I56PgkhU4srvS5p!V68sg66Lh75,ogsg-#,-.,75,gg-#,-.,(558L P,u3hLh-33 68ph6jU4srvS?6?155p!p75,hh-#,-.,75,hh-#,-.,75u3oiri-3,\3j6j-j3,.j6j-.>w6!9@jYkU4p!V5srvS?G97c6,jk-#,-.,,u3kk-3B66f`klU4pxe!4urieVCe8gPp5phS87il88jhB8;8lSoU4s P8PT5txn8W5req V5msg8S5px!P880L8 +PR5lenPH87D5ctxX5pS) 8.0W1nn2c)85hex0R1nn8PHB85 `ovpU4s  S8 PW2txn 85msg8T5px!V880P5lenPS5ctxX5pQ11pvp8481LBO=9epyU4sd 88gp5errhV6qxqDoutq7J9O=+qiq-`=9i=P(b9P5lenW79= rr9=W9=D)p@=S@=@@=V@=79=qss-=9=W9>V)@ >X@>R@!>T74:->sot->>9H>V-S>($:@^>Q@g>P1?tDtEq>7;~>otu->9>W(q:@>P@>\@>V7:>tt->,>tt-?,?tt9+?P-7?)@>S,D?tt-U?,a?tt-s?1tt@?P,?tt9+?P-7?7<?u)w-?9?l(k;@?W@?h@?d@?V@?`F?w7;?`uu- @)0@@Q@!@R,>`umu->,>`umu-?,?`umu9+?P-7?7;:@uu-H@)H@T@PAf<uvE,@7R<>uu9>P,>uu-?,?uu9+?P-7?,0uu-07<a@ v^v-o@-{@,.^vmv-.,.^vmv9.P7<=w4x9=W9=P)`@=S@=L@=V@=H74=>}xx->,>}xx-?,?}xx9+?P-7?,i/Fy{y9w/S-/.s=-7FGsFs=GpF~=y= = .=55Gpx4!/f94H@96H56*srv7H87.->6Gpx!Guri/HP*cH6.~>8zGpxx!/A=yGleny*h{0*l{0I*__v0J>N84;p3!=f932srv5?85?_6.I2sI.>u7./ 6!J?6?= 5!IJD??=)C=D0.a?PC./|B.J?mT?=_S?2tUCJ?9;p!=f92srv?m?82grp.?79K;5"J:@6;grp.?_.2sI?6.:a@9;grp.?8!:@Q9;grp.;sB?A9y4{U4s SA@8zTz2__v>A@8zCz2__v>1CzNz2__v>1z{2__v>A'Azz2__v>1z{2__v>BA?7Q@{|U4sP V5pR#P5errSSBBu5|SU4s W2fd5errP(Ax8#Bp5retS8=S(-B8#+Bl5ret,S8=,S(EB5msg[S7\BBGL-B7|BB9BQ9BP,B9BP-BEG?E)AE3CD^AIFS U 0IB+GQHFej  Dh E#f F#) #-p% #- =$~# /$ # $ # 6 $ # $# $# O$# $# z$# $#$ $#( $#, =$R#0 $X#4 .$~#8 $~#< w$#@ o$">#D $#p#F $$^#G b$(n#H {$1#L $7#T ;$8#X [$:~#\ !$<t#`   d$Rk $T$R#$X#2 $~#p n   3 $/ >f   # #    ) #! # #  w2>q40Y7 %aY p;#ڏ#0#X F## 7    b #  9   ] #  #  # bit ~#u32 "0mZ *_ +#key ,9#In#p#m - m#ref!#< H0wq1D#rq2D#v 3~#04~#450#86R#< 7#@8~#DLLL<74w x#Iym#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$u#(  n(8Hv I0# J0#RK#fdL~# =M0#expN0#3O#4P#w3Q# $4R#$ibS0 #(obS0 #,b T0#0U#40 S=}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0W 0#4~#8"( #< 7#@7#AW#DJ#La #P% #T+ #X_ .tstru#lenv~#p p 0 v  Z zIm#Lm# L#$  #fe#be#~# =~#$. 0#(req0 #,rep0 #0si##4 ###a#srvh#3h#A h#. ##txn#r ~#!###0## w#w#׀##{0#_  < ]e +nk  #!e # u k auid ^&#gid _#\ `# bux au  $ Lfd M~#v N~#+ O~#A= P#  Q #l R~## S~# T0#U U # Vm#( W #? XR#% Y ## Z#W [0# b #u( c# T Qu m # n~#- o~# p~# q# r#  s~#$Q3 t #(h4 u #, v #0c w #4> x #8 y #<? zm#@< {~#HI |m#L   ~~ ~  ~  %Cf%A #b%B0 #} %?cb%C}#R%D#v %E7#ev%F7# %G#%H#   "8len"90#cr":0#U";0##% "Cv"D##[ "Ew#`"Fw#("Gw#2"Hw# n!a    . !)!l!~#m_l!~#u!~#u_l!~# v!~#v_l!~#'!l!~#v_l!~#c!~#c_l!~# r!~#r_l!~#D!rq!yst!D!: !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!#sl!'# | !W#8!~#@!1!n#%!# !6 #req!D#rsp!D#\uri!# !#!#nG!~#=!0# N##~#P# m#X% a^#_%#B`%#au?+U,u#-{#.~#/# 0 %{ ##G&hDp # F#)F#v ~# +~#I~#\~#a#m#,aclm#0]m#8m#@m#H<#Psrvh#\9 ~#`) ~#dR 3 #hU#J #~#c#~#0#~#~#K# ~#& ~##~#~#yІ#1 #R~#~#S,Գ!##~#Zm#%4!#id#Km#d~# ~#d~#0#w0#\0#0# #0## 0#i#Xi#~ i##0#}0#70#F#NF#F#hF##` ~#(#~#0#Z0# 1#i#i#i#i#i#i#  i# i# %i# ~#cap~# 3a# {=a# o ~# o # U # A  a# I  a# J p#  p# J~# R~# ~# ~# ~# q~# p~# ~# D u# nu# ~# 1~# !# 4!# # # ]# {!# } !# ~# a # ~# !#   ~# w!~# "0# #0# $# $#H9ZD 0#V 0#0#ap7 A=4un5< in6azp2u79#% I m#!p #srv"h# h*>|"UIh#v J~# K~#vL~# M~# N# O#&Q#R~# S~#$ S~#(#T0#,6T0#0dU~#4 U~#8V~#<KWm#@ XL#HA=Za#L3[a#\{=]a#lo_~#|o`#@bh#bh#c#_ da#New#f~# g~#;g~#"h~# h~#h~#i~#j~#Fk~#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsD#v tn#huh#wi#wi#Zx0# y1#{i#{i#|i#|i#}i#~# 0#i#~ i#i#%i#,~#L ,z{#t0|#t1|#7}n#U~n#~# ~#$~#(m<#len0#pos0# sid0#srvh#oe#src#buf+ #be u 0#<m# srv# ~#v ~#h Xactt#bckt#,3 act#bck#"!~#% ~# ~#~# ~#~# ~# h#map# #,F #> .!#6.!#u7.!# .!#.!#.!h"!! ~#1~#Q7~#9~# *>~# ~#3~# ~#S,! ! ! !6 "D ~#z<# <# <##s#  #$$P#(Q P#,(P#0i#4%i#< #px#svh#w#w# =0# iid~#G~#sid~#$# ͘##iid~#px#buf0#sid0# ptr~#bol~## >'˖"  # $# # z#p ##p #!-$}:+~͌U"si*Q#-$$>$P$I$R%U$k~&j~'nowj~(y$:5ЌU"si4R($^:CU"siBQ"msgB$S)$$ A$$R#$Aw$$R$ 6 *$/~'buf}0 (%I:TBU"siSS"msgS$Q)E%%$%P)\%$+$)s%%+%)%%$&Q$&P#&$,&P+7&#C&+P&*%p:'buf0 *%&'buf0 %& #W~'nowV~&%V~%C&!L~'nowK~&%K~*\&$'buf0 ,2#i&e, #i&,%t&,%u~ &- ,&Q&,';0,(Q0,(R0,(U0, (V, (W'D4`C2P: G0A@  "0<7< &iB 5into 60 >EG ?E) AE3 C D^AIF S U  0IB+GQHFpj DhE#fF#) )-{% )- =*# /* # * # 6 * # *# *# O*# *# z*# *#$ *#( *#, =*h#0 *n#4 .*#8 *#< w*#@ o*">#D *#p#F *$t#G b*(#H {*1#L *7#T ;*8#X [*:#\ !*<#` 7  d*hk *T*h#*n#2 *#1{  *  3 Q!3!4#!5#T!6# !7# {!8#!9# !:#N ,- -#N .# /# 0N#  $/ >f   _# #   ) _#! # #  wtm,wx#y#z#{# |#}#~### f#$Z#(2>q40Y7 Y p#_#ۦ#X ܼ## ,7 O bO# __ ,  ]4# _# _# bit#u32"0Z*_+e#key,#I n #p #7 - #ref !# H 0wq 1#rq 2#v 3#0 4#4 50#8 6#< 7#@ 8#D7g74w x$#Iy#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$ug#( w E n(8#Hv #I0# #J0#R#K#fd#L# =#M0#exp#N0#3#OW #4#PW #w3#QW # $4#RW #$ib#S #(ob#S #,b #T0#0#U#4Q Q wE  #S=}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0W 0#4#8"( #< 7#@7#AW#DJQ #La Q #P #T #X]  .tstru#lenv#     Z zI"#L"# "#$ "j#fe"#be"#"# ="#$. "0#(req" #,rep" #0si"!#4 "##"#"#srv"d#3"d#A "d#. "!#txn"#r "#"#"!#0"!# "w#"w#"v!#{"0#  $ #J$!#a $"#U$# #  ] +nk  _#! # * k] auid^1#gid_#\`&#p buxa* w$ LfdM#v N#+O#A=P#  Qd#lR##S#T0#UUj#V#(W#?X#%Y##Z#W [0#b] #u(c#d TQum#n#-o#p# q_# rT# s#$Q3t#(h4u#,v#0cw#4>x#8y#<?z#@<{#HI|#Lwp p  d+Cf+A#b+B #2 +?cb+C2#R+D#v +E7#ev+F7# +GB#+HT# B j N###P# #H a^#_%#B`%#a/?+U,/#-5#.#/# ; i{ #{#uui '8len'90#cr':0#U';0#% 'Cv'D#[ 'Ew#`'Fw#('Gw#2'Hw# \&a    . &&l&݉#m_l&މ#u&߉#u_l&߉# v&#v_l&#&l&#v_l&#c&#c_l&# r&#r_l&#2&rq&gst&D&: &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&N#sl&# | &W#8&#@v&1&\#%&# & #req&2#rsp&2#\uri&# &#&#nG&#=&0#ZD 0#V 0#0#d*>|HUId#v J# K#vL# M# N# O#&Q#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KW#@ X#HA=Z#L3[#\{=]#lo_#|o`#@bd#bd#c#_ d#New#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v t#hud#wi#wi#Zx0# y<#{i#{i#|i#|i#}i#~v# 0#i#~ i#i#%i#,#&hDQpj# #)#v # +#I#\## ##,acl#0]#8#@#H<>##Psrvd#\9 #`) #dR ##hU#J #ĉ#c#Ɖ#0#ȉ#ɉ#K# ˉ#& ̉##Ή#ω#y@#1 #R҉#Ӊ#S,%##։#Z#%$#id#K#d# #d#0#w0#\0#0# v#0#v# 0#i#Xi#~ i##0#}0#70##N##h##` #(##0#Z0# <#i#i#i#i#i#i#  i# i# %i# #cap# 3# {=# o # o # U # A  "# I  "# J p#  p# J# R# # # # q# p# # D /# n/# # 1# %# 4%# # # ]# {%# } %# # a # # %#   # w!# "0# #0# $"# $"#Hj4% %I% #%! #srv%"d#  D" "#z"G# "G# "G#"#s"#  "#$$"P#(Q "P#,("P#0"i#4%"i#<!"px"Ƙ#sv"d#"w#"w# ="0# iid"ʉ#G"ʉ#sid"ʉ#! ""#v!"iid"Љ#px"ј#buf"0#sid"0# ptr"ԉ#bol"Չ#!" >'"ˌ "! "! !w ! !! Q !G"p7 A=4jun5 in6'"p2u7!#"L ,z{4#t0|4#t1|4#7}#U~## #$#( #G#len0#pos0# sid0#srvd#oe#src#buf #>#be uc# 0#<## srv## #v #d#Xact'"#bck'"#,#act4#bck4#$#% # ## ## # d#mapc## ##,F##> $#6$#u7$# $#$#$d$`% ى#1ډ#Q7ۉ#9܉# *>݉# މ#3߉# #%S, &#'#Y(#4)# =*#-+&#,'#U-%#`%! % % & E& 0$^0%#kw0&#0-n&#n&NE&&05I06#kw07&# &&"& U&###&' U'##7#&f',R,N#,O#+,P# ,Q# ( ,;uid,<#gid,=#,>##,?# ,@# ,A#,B#8,C#\,D# ?,E#$,F#(,G#,',H#0J,I#4,I#8J,J#<R,J#@,K#D ,K#HA ,L"#LI ,L"#,R%'# ,Sp #c,T##+;<PU$<:N~$:: $::$&;%err;$2;&W)'>%'s>%&*(su? ~)w@S*)3`'^%'s^%+3`'^)^P*)h{'b%'sb%* *'f%'sf%*-*'q%'sq%&D*)r+P** 'Z%'sZ%+ 'Z)ZP,*+(A-+.+(A-,-,-(,/)H!g5,P**'%'s%*+'%'s%&_+8'#.+ɐ-+.+ɐ-,-,-(,,++-+.+-,-,-(,,++)-,-,-(,/P)%0~(resP 0+n1m05, -1+1O+N1,2s,:*U%msgs,$[   3-a;g0U4sf 4pxf 4urif%R5reph d5svid`5svsid\5msgj h&-p6: *-56u'S7lenv+ݒ8%8s%+ݒ86P&-6:4-0l/6d#0P&-6:-Ll/(6d#0P - 3.;HU4sG V4repG W4uriG%7pxI5msgJ h5upK0S,u.. -.,..57-...b-.9.*:buf ;.:U:nTP2d/R;U%s V%rep W%uri%0P*`0IJ7__v>*z0Rb7__v>/h8j;0y;[:tZ=1;vU4su 4repu  ?Pw15msgx @U%&15es2~,61.eh-.&18r;6:~. 2Ƶ-2-+2-72-C2>O2~/A[2~Ag2Q&15pnr25tm.2>2~>2P..-. 2 "Br2;?Cout=s,1[ =Cerr>21,>Cptr>7end@7cA7 2 -D2Cnow2Ctm2 <E!;  2UF(K22 >FU(L22 ~F(M2F2)3pF )3F+t03F+uF ,[ a3G FQP3 y3GF&†3 n3?&<F-;0Hnow-GF,Wf'Hpid,YF2,ZF,] FZ.Fe.F /FQ0FR0FS0FT0FU0F VF Wv46&t&l 61G@< G0A@  "0<7< &iBR 27 5into 60 >EG ?E) AE3 C D^AIF S U  0I B+ G QHF< >= 0j !Dh!E#f!F#) )-/% )- =*# /* # * # 6 * # *# *# O*# *# z*# *#$ *#( *#, =*#0 *#4 .*#8 *#< w*#@ o*">#D *#p#F *$#G b*(#H {*1#L *7$#T ;*8$#X [*:#\ !*<#`5 7@ :$W c $ d*k *T*#*#2 *#jc3$/>f ##" Y)#!#Y#iwC6 7# A8#+nk  #!#k 2>q 40Y7 Y p#Z##X #Z#j7 b#j  ]r# # # bit#u32"0!Z*_+#key,#FInF#pF#!u - !#ref!F# H0wq1#rq2#v 3#04#450#86#< 7$#@8#D u74 w xK#I y!#` z0# x {0#b& |0#r }0#[ ~0#= 0# - 0#$u #( n(8"Hv "I0# "J0#R"K$#fd"L# ="M0#exp"N0#3"O#4"P#w3"Q# $4"R#$ib"S #(ob"S #,b "T0#0"U$#4   "S=}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0W 0#4#8"( #< 7#@7#AW#DJ#La #P #T #X .tstru#lenv# $  $ *  Z zI!#L!# #$ 0#fei#bei## =#$. 0#(req #,rep #0siq #4 "##"##srv5#35#A 5#.  #txn#r ## #0 # ‚#Â#G #{0#   ]# auid ^<#gid _&#\ `1#6 bux a = $ Lfd M#v N#+ O#A= P"#  Q*#l R## S# T0#U U0# V!#( WF#? X#% YL## Z$#W [0# b# #u( c#* T Qu mR# n#- o# p# q# r#  s#$Q3 tF#(h4 uF#, vr#0c wr#4> xr#8 yr#<? z!#@< {#HI |!#L= 6 F 6br *b+Cf+AF#b+B # +?cb+C#R+D$#v +E7#ev+F7# +G#+H#x f N###P# !#  a^$#_%#B`%#aw?+U,#-#.#/:#  4{ F#F# @ @f4 %8len%90#cr%:0#U%;0#% %Cv%D#[ %E#`%F#(%G#2%H# L'$a    . $$l$ݔ#m_l$ޔ#u$ߔ#u_l$ߔ# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$#$rq$2st$D$: $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڣ#sl$# | $W#8$#@G$1$'#%$# $ #req$#rsp$#\uri$# $#$#nG$#=$0#~ZD 0#V 0#0#5*>|HUI5#v J# K#vL# M# N# O#&Qi#R# S#$ S#(#T0#,6T0#0dU#4 U#8V#<KW!#@ X#HA=Z#L3[#\{=]#lo_#|o`#@b5#b5#c#_ d#Ne#f# g#;g#"h# h#h#i#j#Fk#idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v to#hu5#wi#wi#Zx0# yG#{i#{i#|i#|i#}i#~G# 0#i#~ i#i#%i#,#~i&hDQp0# #)#v # +#I#\##`&#,acl!#0]!#8!#@!#H<~&#Psrv5#\9 #`) #dR &'#hU#J #Ĕ#c#Ɣ#0#Ȕ#ɔ#K# ˔#& ̔##Δ#ϔ#y #1 #RҔ#Ӕ#S,Ԧ(##֔#Z!#%'(#id#K!#d# #d#0#w0#\0#0# G#0#G# 0#i#Xi#~ i##0#}0#70##N##h##` #(##0#Z0# G#i#i#i#i#i#i#  i# i# %i# #cap# 3# {=# o # o # U i# A  N%# I  N%# J p#  p# J# R# # # # q# p# # D # n# # 1# (# 4(# q# q# ]q# {(# } (# # a # # (#   # w!# "0# #0# $%# $%#H;r% #I# !##!$ #srv#"5# ]D #zh# h# h##s#  #$$P#(Q P#,(P#0i#4%i#<pxi#sv5#Ȃ#Ȃ# =0# iidʔ#Gʔ#sidʔ# L#G iidД#pxi#buf0#sid0# ptrԔ#bolՔ#q  >']   u  $   $  !$'dow'#h1'#m1'#h2' #m2'#U!'min'i#max'i#]$'˔#$'̔#z!'A='#'#!'i'Ȕ '! #'U! $'Ұ !'ptr'$str'reg'!>"$,'I'!#val'z!#ptr'ح!#e$'Q# len'ڔ#$='۔#(u" 'p'$i'll'id'u"a'|"G"$"$0'i'#ptr'#len'#='# ctx'>"#D#0$'kw':# 'd## $'## @'$# '0# %' #^# E ^# L!D## i $ $ # ###;@' I'!!#kw'"h$#arg'%R$# %'&# '$''!#"j#$ # ^##C$%' I'!#kw'C$#R$"!"h$'%#str'$"$$acl'* I'+!# u',# cA'-!# '.# '/0#n$&%{A'> I'?!# ;'@!#pol'A# 'B0# ,'C#N%p7 A=4un5in6g%p2u7&%#%L ,z{r#t0|r#t1|r#7}o#U~o## #$#(`&h#len0#pos0# sid0#srv5#oei#src"#buf #~&bei u& 0#<!#& srv&# #v #5'Xactg%#bckg%#,&'actr#bckr#(#% # ## ## # 5#map&# &#,F'#> !(#6!(#u7!(# !(#!(# !( 5(( ٔ#1ڔ#Q7۔#9ܔ# *>ݔ# ޔ#3ߔ# #S,( (( ( $) 0$^0%#kw0&:#0-=)#=)  i i )k)05I06!#kw07k)#z)(!).R.N#.O#+.P# .Q# + .;uid.<#gid.=#.>##.?# .@# .A#.B#8.C#\.D# ?.E#$.F#(.G#,'.H#0J.I#4.I#8J.J#<R.J#@.K#D .K#HA .LN%#LI .LN%#.Rz)# .S6 #c.T#T+=&$I&%!#B&&(#&'# }+x= == >#:< ?R#%+< F  G] A= HT+ = I]+< Bop D]#v J}+#&.-@<n@ܼU'fdmV(=mS(<m.-(#m.-)<=oX)F=pW*retqP)V=tm+,f,__s~$,~ ~0 ~> ~7,__u~4-,__c~w-0)n=+H)s=+. *__s$R- 0 > 7,__u:-,__cwr,,&-<U($ 0V( (2/1=/l<޾*fdS*errd*msg:`0-&01-2-!T3fdS46.}<(DU5 '*R6$ )0S7err*V8].;:PU5$ 90Q8.<HU5$ G0Q9/<glU:sf$ V:reqf W6$h/S6;ip;./6M/k?j3nowj2/p:3buf 2/'3buf >0 #W3nowV?%V>90!L3nowK?%K42<pU5<5: 5:i5&i:err527ptr:l7val0p6=Q+1@%@s%+&1@%@s%=&2`6h6Q=d7polQ6B(S@$/+1@%@s%+1@%@s%=2@%@s%.@/6P-=G@%@s%;?22 <3P;X22<3P=~27acl $P6u:Q;22Th<3P;22<3P;22<3P;221302[m13>32:?&1i43<*U:px(i:l4($ P:l7($:dir(5cA)#5$)#R44;>U:px<i:l4<$ P:l7<$:dir<5cA=#5$=#6?p6h=?V6<?R6@/S/'=p/<.6^Q68^l64<^h6R<^d6.<^`AX<UBU(L44 B(M4B2)4B )4B+t4B+u5CB,Q 5D&<iB-;0Enow- G"0Aint@ "0<7<&wBo60>SG?S)AS3C7DlAIFS7 U7 0IB+GQHFej %Dh%E#f%F#I  n # p #e - e# ref !#R74$w $xR#I$ye#`$z0# x ${0#b&$|0#r$}0#[ $~0#=$0# -$0#$u$X#( h  #U##u##Z#># len# ># #!>#C#"#h2Lq40Y7 Y p#$/L[f '#[# k )'#!##  w'##X ## E 0+nk  '#!0# @ k hp7 A=42un5in6p2 u7@# b#   ]### bit>#u32 "08Z *_ +# key ,# H 0 wq 1# rq 2#v 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#\`#  buxa$ L fdM>#v N>#+O>#A=Pk#  Q #lR>##S>#T0#UU#Ve#(W%#?X#%Y+##Z#W [0#b#u(c#  TQum1#n>#-o>#p># q'# r# s>#$Q3t%#(h4u%#,vQ#0cwQ#4>xQ#8yQ#<?ze#@<{>#HI|e#L%>>> A Q> A*R*N>#*O>#+*P># *Q>#   *; uid*<># gid*=>#*>>##*?># *@># *A>#*B>#8*C>#\*D># ?*E>#$*F>#(*G#,'*H#0J*I>#4*I>#8J*J>#<R*J>#@*K>#D *K>#HA *Lh#LI *Lh#*RW# *S#c*T># n(8&Hv &I0# &J0#R&K# fd&L># =&M0# exp&N0#3&O #4&P #w3&Q # $4&R #$ ib&S) #( ob&S) #,b &T0#0&U#4    ) &S= }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0W 0#4 >#8"( #< E#@ E#A e#DJ #La #P ]#T c#X X . t str u# len v>#i i ) o Z  zI e#L e# #$ # fe X# be X# ># = >#$. 0#( req ) #, rep ) #0 si %#4 k## k# # srv #3 #A #. %# txn #r ># "$# &#0 &# …# Å# ׽%#{ 0#X ] ' >#J'!>#a '">#U'#]#  t] )8len)90#cr):0#U);0#% )C v)D#[ )E#`)F#()G#2)H# tO(a    . ( ( l(># m_l(># u(># u_l(># v(># v_l(>#( l(># v_l(># c(># c_l(># r(># r_l(># %(rq(Zst(D(: (0# sol(# eol(# som(0# col(0# sov(0# eoh(0# cap(# sl(# | (e#8(>#@o(1(O#%(# (/ # req(%# rsp(%#\ uri(# (#(#nG(>#=(0#u N##>#^# e#z  !a!^#!_%#B!`%#!a[? +U ,[# -a# .># /o# g { ##) ,-K% ,-=->#/- #- #6 - #  -#-#O-# -#z-# -#$-#(-#,=-#0-#4.->#8->#<w-#@o-"L#D -#~#F-$#Gb-(#H{-1#L-7#T;-8#X[-:>#\ !-<#`d-k -T-#-#2 ->#R  K  3+C f+A%# b+B) #; +? cb+C;#R+D#v +EE# ev+FE# +GK#+H# K 2G^&hDp# #)#v ># +>#I>#\>##!#, acle#0]e#8e#@e#H<!#P srv #\9 >#`) >#dR |"#hU#J #>#c#>#0#>#>#K# >#& >##>#>#yl#1 #R>#>#S,###>#Ze#%}## id#Ke#d># >#d>#0#w0#\0#0# #0## 0#w#Xw#~ w##0#}0#70##N##h##` >#(#>#0#Z0# 1#w#w#w#w#w#w# w#w#%w#>#cap>#3#{=#o >#o #U X#A  h#I  h#J ~# ~#J>#R>#># ># >#q>#p>#>#D [#n[#>#1>##4###]#{$#} $#>#a #>#$#  >#w!>#"0# #0#$8!#$8!#HZD 0#V 0#0#% I e#!i # srv" #  *>|"UI #v J># K>#vL># M># N# O#&QX#R># S>#$ S>#(#T0#,6T0#0dU>#4 U>#8V>#<KWe#@ X#HA=Z#L3[#\{=]#lo_>#|o`#@b #b #c#_ d#Ne#f># g>#;g>#"h># h>#h>#i>#j>#Fk># idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gs#v t #hu #ww#ww#Zx0# y1#{w#{w#|w#|w#}w#~# 0#w#~ w#w#%w#,>#8!L ,z{# t0|# t1|#7} #U~ #># >#$>#(!<# len0# pos0# sid0# srv # oeX# srck# bufc# !beX u! 0#<e#,"  srv,"# >#v ># W"X act # bck #,|" act# bck#k#>#% ># >#># >#># >#  # map!# 2"#,FW"#> w##6w##u7w## w##w##w# k## >#1>#Q7>#9># *>># >#3># ># S,# $ "$/ $D  >#z <# <#  <# 7#s 7#  7#$$ ^#(Q ^#,( ^#0 w#4% w#<J% px X# sv DZ # ȅ# ȅ# = 0# iid >#G ># sid >#a%  ͐#% iid ># px X# buf 0# sid 0# ptr ># bol ># % >' $  J% a% %  &i % &i  &![&>[U"i V"  S#)'>/`U$s.i V%txn0)'p%fe1Xl&2/'R&(2/'S'&5'(F')O'P*&V%h[S+&,ji+',jo-%hUS.Y'-7F>/sFY'/pFd'_'j'^01>>/U#'=0U$si V&>eQR1,(=> cU$si V$si S%req) P%rep) Q2,(c{(>((J(304V(P5c(J^6tv1Ic(6tv2Ic(7retK^i(<1(M>>pU$si V$si W'(())P()'(5'a(F'(O'25'(F'(O'.)!L>/nowK>8%K>!)>>=U9s<i V9si< W:req>) p:rep?) S'))()()2)3:()();)+/buf) 8[ >!T+=f\U9sei V9sie S'*,((>((J(3P4V(P'E*,((>((J(3h4V(P+*<6q>P2T+s(a+2k+z)x+Q(+'*,(Jc(>((J(34V(P'*T+(a+2k+)x+R(+'+5'Bu(F'(O'')+,((>((J(34V(P'@++(+2+#=(+;k+-(/s' ;+p$0/ctr/+/inc/0;+%!/ctr +!+=`U9si Q=0(2LU9t1:s3i V<(4>p<(50l<(50h>g(=>+(U>& @+,?=020(0+,( <=0R20x{(0',0(0'-0f(1(1',0f)1R)1W20)1R)1W':-0(1)1S'V-0(1(1'r-0 (1(1'-0(0'-1((1(31-4>1P'-1 -((1(31- -4>1P'&.J1@(X1(b12,()>(W(J(3` 4V(P'=.n1;H({1'T.n1$1({1'k.1Q[(1*.?=0'.1&(1'.n1;=({1'.5')F'S)O'P+.x :len*>P'/,((>((J(-4V(P'B/1(121(1'l/11(121(1'/21o(!22+2;o(<221;I)1P'/F2o(S2'/]2(j2'/t2)2P)2Q'0t2)2P)2Q'90t2)2P)2Q'0]2(j2'o0t2 7)2P)2W'0t2<S)2P)2W2t2_z)2P)2W-M7len>;0$/buf) ;0(t/bufs) .1"u>/t1t>/t2t>;J1'c/bufb) 8>b0,&d0@n1=6si 6si ;1c'/buf) ;1&/buf) .1"/t.1 ~/t}.1 v/tu; 2 ]8| \ 2.+2/t.F2/t;]2/t;t2'M/bL) .2k>8j>/nowj>!2=PU9si Q9si PP:err>S:fin>RAD #%A*WA +w>A*]cA2,93A ,93A+tY3A+u> }3B A.Ql3A;0Cnow<<A $A/#DT (`D )eXAZ0>AQ0AR0AU0A VA W 2=lNH\z> d 8len9d#cr:d#U;d#A% CvD#[ E#`F#(G#2H# % 3n>3\U len3 cr3 I:W >3 e%V new3Q intk:G?:)A:3CDSAIFS U % 9j DhE#fF#7 [J|G[# k9 ?JDIB+GQ/ 3f   # #   ) #! z# # " w( 23q4%Y-7 8tY pN#ڗ#C#X Y## , ) -g% - =s# / #  # 6  # # # O# # z# #$ #( #, =#0 #4 .s#8 s#< w#@ o"3#D #e#F $#G b(#H {1#L 7#T ;8#X [:s#\ !<#`dk T##2 s#t  m  3 b#  `  ]# # # bits#u32"%Z*_+#key,`#In#p#: H0wq1k#rq2k#v 3s#04s#45%#86P#< 7#@8s#DJJJ:74w xg#Iy#`z%# x {%#b&|%#r}%#[ ~%#=%# -%#$u#(  n(8Hv I%# J%#RK#fdLs# =M%#expN%#3O#4P#w3Q# $4R#$ibS. #(obS. #,b T%#0U#4. S= }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0W %#4 s#8"( Q #< ,#@ ,#A L#DJ #La #P ] #T c #XE E . K Z 4 W t ] +nk  #! # k auid^#gid_v#\`# buxa  $ LfdMs#v Ns#+Os#A=P#  Q #lRs##Ss#T%#UU #V#(W #?XP#%Y ##Z#W [%#b #u(c# TQum #ns#-os#ps# q# r# ss#$Q3t #(h4u #,v/ #0cw/ #4>x/ #8y/ #<?z#@<{s#HI|#L   ss s  / s  V CfA #bB. #  ?cbC #RD#v E,#evF,# G #H# 5  <]#^#>_ #set` #clra # q?b #>c #remd #cloe #f3f # 7g #$r@h#($i #,Ej #0uk"#4ls#8 s s s      s   s   Ip7A=4un5t in6tbp2u7!# RNs#Os#+Ps# Qs#  ;uids##?s# @s# As#Bs#8Cs#\Ds# ?Es#$Fs#(G#,'H#0JIs#4Is#8JJs#<RJs#@Ks#D Ks#HA LI#LI LI#Rb# S #cTs#P>'s`Ufd& Rdir&sQf (P?,sUfd+ Pdir+sR?2sUfd1 Pdir1sRl?8sUfd7 Rdir7sP!ret9sP :Pd>As@Ufd@ Pdir@sR!retBsP" CP#>J@dUfdIsP#>SpUpR expRsR nGTsS!fdUsW!iUsQ Vh >Wsd `?XsV >XsS!fdsYs` Z_$G  P$b P%~DV&&'VX&&(ks)js*nowjs(&s*nows*expsF,?sUp V+5?+>+@?+>ý >sS#h>Up S>s *Up #J?0U!p R,2, ,ps  ,r,tV ,us ,- , Q,;%,W,s,Q%,R%,U%, VV, Wk  k $? W? &lQG? intC?C#SZSA<?,?0aG ՂA@ "7<&Bo6>G?)A3CD IFS U   S _ %HF p IB+GQj "Dh"E#f"F*#2q4Y7 Y p#$@/Ef #E#US )#!##Sw##X ##S) -% -=%#/ # #6  #  ##O# #z# #$#(#,=#0#4.%#8%#<w#@o"#D ##F$#Gb(#H{15#L7K#T;8K#X[:%#\ !<#` Kdk T##2 %#  S S3( b(#88S  ] #8#8# bit%#u32"Z*_+>#key,#I n #p #  - #ref !# H 0wq 1#rq 2#v 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @74!w !x#I!y#`!z# x !{#b&!|#r!}#[ !~#=!# -!#$u!@#(PS n(8 Hv I# J#R KK#fd L%# = M#exp N#3 O0#4 P0#w3 Q0# $4 R0#$ib S #(ob S #,b T#0 UK#4 * * P   S= }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0W #4 %#8"( h #< #@ #A #DJ *#La *#P t #T z #X 6 . tstr u#len v%#    h Z  zI #L # #$ #fe #be # %# = %#$. #(req  #,rep  #0si #4 U## U# #srv n#3 n#A n#. #txn #r %# # #0 # # # ׀ #{ ؂#   n  S] +nk  #! # Sk auid^#gid_u#\`# buxa  $ LfdM%#v N%#+O%#A=PU#  Q #lR%##S%#T#UU#V#(W#?X#%Y ##ZK#W [#b #u(c# TQum&#n%#-o%#p%# q# r# s%#$Q3t#(h4u#,vF#0cwF#4>xF#8yF#<?z#@<{%#HI|#L   % %   %6SF% 6mCfA#bB # ?cbC#RDK#v E#evF# G#H#LS  ?%#?M#3p7A=4un5 in6Lp2u7 # N##%#Z# #L  a^K#_w#B`w#a3?+U,3#-9#.%#/j#  ? m{ ## y y  m %8len%9#cr%:#U%;#% %Cv%D#[ %E#`%F#(%G#2%H# `$   a        . $$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#6$rq$kst$D$: $Ԃ#sol$#eol$#som$ׂ# col$؂#sov$؂#eoh$ق#cap$#sl$# | $#8$%#@ $1$`#%$# $ #req$6#rsp$6#\uri$# $#$#nG$%#=$#ZD #V ##n*>|HUIn#v J%# K%#vL%# M%# N# O#&Q#R%# S%#$ S%#(#T#,6T#0dU%#4 U%#8V%#<KW#@ X#HA=Z#L3[#\{=]#lo_%#|o`#@bn#bn#c#_ d#Ne#f%# g%#;g%#"h%# h%#h%#i%#j%#Fk%#idm#n#L n#o# p#Oq#r#Vr#gs#v t#hun#w#w#Zx# y_#{#{#|#|#}#~# ##~ ##%#,%# &hDQp# #)#v %# +%#I%#\%##!#,acl#0]#8#@#H<"#Psrvn#\9 %#`) %#dR "#hU#J #%#c#%#ǂ#%#%#K# %#& %##%#%#yD#1 #R%#%#S,/$##%#Z׼#%##id#K#d%# %#d%##w#\## ### ##X#~ ###}#7##N##h##` %#(#%##Z# _####### ##%#%#cap%#3#{=#o %#o #U #A  3#I  3#J # #J%#R%#%# %# %#q%#p%#%#D 3#n3#%#1%#;$#4;$###]#{A$#} A$#%#a #%#Q$#  %#w!%#"# ##$k!#$k!#H t  % #I# ##! #srv#"n# D  %#z # #  # #s #  #$$ Z#(Q Z#,( Z#0 #4% #<  px Ƣ#sv n# # # = ɂ# iid %#G %#sid %#$  #  iid %#px Ѣ#buf ҂#sid ӂ# ptr %#bol %#  >' ˖  $  PS     *  Gk!L ,z{ #t0| #t1| #7}#U~#%# %#$%#(!#len#pos# sid#srvn#oe#srcU#bufz #"beu," #<#_" srv_"# %#v %# n"Xact #bck #,"act #bck ##%#% %# %#%# %#%# %# n#map,"# e"#,F"#> ##6##u7## #### # n #)$ %#1%#Q7%#9%# *>%# %#3%# %#S, )$  5$Q$S a$ S!$@U"$#__s K$#__s!K%$?&U&sig%%S%$@@$U&sig?%P'??MR!J%?[0U(sig\%R)?\%V)&*]J%P)x?^l~ *2]% * ]%*&]%*t% m*u%%+S*&Q%,%%S,?%%%S,?%,?l,<S2@ G0A@ "0<7<&iB5into60>EG?E)AE3CD^AIFS U 0) #-&% #-=$#/$ #$ #6 $ #  $#$#O$# $#z$# $#$$#($#,=$+#0$1#4.$#8$#<w$#@o$">#D $#p#F$$7#Gb$(G#H{$1#L$7#T;$8#X[$:#\ !$<M#` 7    d$+k $ T$+# $1# 2 $#&G]3I n #p #]  - ]#ref !#HFI B+ G Qj D hE# fF#2>q40Y7 MY  p'#$/>f  X# #  )X# !# #w( X# # X 2# (#87 [  b [#kk8  ] @# k# k# bit #u32 "0Z * _ +q#key ,#j H 0wq 1#rq 2# v 3#0  4#4  50#8  6#< 7#@  8#Dzz zj74w x# Iy]# `z0# x {0# b&|0# r}0# [ ~0# =0# -0#$ u#(/ n(8H v I0#  J0# RK#fdL# =M0#expN0# 3O# 4P# w3Q# $4R#$ibS^ #(obS^ #, b T0#0 U#4  /^ S =}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 W 0#4 #8 "(G #< 7#@ 7#A W#D J #L a  #P S #T Y #X .tstru#lenv#  ^  G Z z I]# L]# z# $  #feX#beX# # =#$ . 0#(req^ #,rep^ #0si` #4 # ## #srv$# 3$# A $# . p #txn# r # #  # 0 #  w# w# 6 # {0# M j ] +n k  X# ! # k auid^#gid_# \`# buxa  $ LfdM# v N# +O# A=P# Q # lR# #S# T0# UU # V]# (W # ?X# %Y # #Z# W [0# b # u(c# TQ um# n# -o# p# qX# rM# s#$ Q3t #( h4u #, v%#0 cw%#4 >x%#8 y%#< ?z]#@ <{#H I|]#L     % L%Cf%A #b%B^ # %?cb%C# R%D# v %E7#ev%F7# %G# %HM#+c  N# # # P# ]#X a ^# _%# B`%#a%?+ U,# -# .# /# c X { # #  1ZD  0# V 0# 0#Yp7A=4cun5j in6rp2u71#  8len 90#cr :0#U ;0#% Cv D# [ Ew# ` Fw# ( Gw# 2 Hw# rM   a        . l݉#m_lމ#u߉#u_l߉# v#v_l#l#v_l#c#c_l# r#r_l##rqXstD : 0#sol#eol#som0# col0#sov0#eoh0#cap#sl# | W#8 #@m 1M# %# d #req##rsp##\uri# # # nG# =0#$*>|H UI$# v J#  K# vL# M# N#  O# &QX# R# S#$ S#( #T0#, 6T0#0 dU#4  U#8 V#< KW]#@ Xz#H A=Z#L 3[#\ {=]#l o_#| o`# @b$# b$# c# _ d# New# f# g# ;g# "h# h# h# i# j# Fk#idm# n0# L n0# o0# p0# Oq0# r0# Vr0# gs# v t^# hu$# wi# wi# Zx0# y# {i# {i# |i# |i# }i# ~# 0# i# ~ i# i# %i# ,#mX&hDQ p # 2# )2# v # +# I# \# # !#,acl]#0 ]]#8 ]#@ ]#H <!#Psrv$#\ 9 #` ) #d R ^"#h U# J # ĉ# c# Ɖ# 0# ȉ# ɉ# K# ˉ# & ̉# # Ή# ω# yй# 1 # R҉# Ӊ# S,## # ։# Z]# %_##id# K]# d#  # d# 0# w0# \0# 0# # 0# # 0# i# Xi# ~ i# #0# }0# 70# 2# N2# 2# h2# # ` # (# # 0# Z0# # i# i# i# i# i# i# i#i#%i##cap#3#{=#o #o #U X#A  Y#I  Y#J p# p#J#R## # #q#p##D #n##1###4####]#{##} ###a ##$#  #w!#"0# #0#$!#$!#H*@%  I ]# ! #srv"$# LD # z# # # # s# #$ $P#( Q P#, (P#0 i#4 %i#<pxX#sv$# w# w# =0# iidʉ# Gʉ#sidʉ#  ͈#6 iidЉ#pxX#buf0#sid0# ptrԉ#bolՉ#` >'Lp /d  v   !L ,z {@#t0|@#t1|@# 7}^# U~^# # #$ #(! #len0#pos0# sid0#srv$#oeX#src#bufY #!beXu!  0# <]#" srv"# # v #$9"Xact #bck #,^"act@#bck@#M# # % # # # # # # $#map!# "#, F9"# > Y## 6Y## u7Y## Y## Y## Y# $M##  ى# 1ډ# Q7ۉ# 9܉# *>݉# މ# 3߉# #S,# #$ $d i${A)I!?]#;!@]#pol!A#!B0#,!C#$$$!dow!#h1!#m1!#h2! #m2!#%!min!i#max!i#]$!ˉ#$!̉#9%! A=!2# !2#l%!i!ȉ!$#!%$!o$%!ptr!str!reg!ז%X%$,! I!]#val!9%#ptr!l%# e$!# len!ډ#$ =!ۉ#(4& !p!i!ll!id!4&a!;&GK&&$0!i!#ptr!#len!# =!# ctx!%#'0$!kw!#!#'#$!'#@!'# !0#%! #'  ' %'R' X  R' 'X'';@!I!!]#kw!"'(#arg!%(# %!&#'$!']#K&)'' ' ''(%!I!]#kw!(#(&!"'(!%#str!$&$(acl!*I!+]#u!,#cA!-]#  !.#!/0#(B!3I!4]#acl!5(#neg!6# -((A!9I!:]#@!;]#%)u#cA)#+)&)3B;U'px9X'l49  'l79'dir9(cA:R'($:'P&*rCF U'pxDX'l4D  'l7D'dirD(cAER'($E'P&l*@S 6U'pxQX'l4Q  'l7Q'dirQ(cARR'($R'P)*B_@JU( ^(\C^' (P/^ )+J@fPZU'pxdX'l4d  'l7d'dird(cAeR'($e')W+Al`gU($k'(\Ck' )+CspU($r'S(\Cr'Q*0t)+BU($'V(\C'P+#AS,ret-1+AS)>,CU($'S(\C'Q*0),AeU($'P(\C'V*0)-Cp0U($ư'S(\C' *0ȉ.endW.cS/, +ӉR-*Ӊ&-'C0U($'W(\C'R()s+@l+0h.cW.endd.psV.plS/- 0 1 2 P3-@U4$'P4\C'R31.;A'U4$&'P4\C&'R3l.dC-=U4$,'4\C,' 3.A5@iU4$4'R4\C4'Q5s6.R23 /ACpU4 BS4\CB'W4P/B 6lenD72/hAOU8ptrO3/@V$U4 UP4\CU'V4P/U 2W%S20XP31%Bv0dU4 uV4\Cu' 4P/u 5iwiVW5jx0Q2(x0p2ex0l5ptryS9q0y0}%0s}%-y0}2}P900~%0s~%-0~2~P/0 0%0s%1!02P/?1 !0%0s%18!02P-+0%0s%-+02P3r3ApU4 V4\C' 4P/ 5iih5j0V2(0d2e0`5ptrW9]20%0s%-02P920%0s%-02P/2P!0%0s%1h!02P/+3!0%0s%1!02P-Nf0%0s%-Nf02P33\@ U4 P4\C'P4P/ :3NB,U8kwl+3P': 4B4 U8kwl33P1!0j534w@=(PU4u<W4<<V5acl>(S-#20@%0s@%34BBJ'(PU8kwI0K25ALP5kwlM3W75WC^LU8pat]'S;W5DCrR'PU4cAqR'Wq5P>}5V?5@k@<j6patl'6tmpl'3k6AR'mU4<VAAAZA0ASC%2cAR'\2@'(X2\C'S2P/`2@W5argT/R6!6end0C-5retR36@(pU8acl(2cAR'S2D@R'V-0j3P7B(U4<V4{BWAApA2@[A CO2CU"L=;C; ~C"M=;C2#b;C #b;C%t;LC%u;DC&Q;;; 0E @;@8 ;+A.' n<< (FIA<6 ;2$h'm5&`W C G0Aint@ "0<7<&wBo60>SG?S)AS3C7DlAIFS7 U7 0IB+GQHFej DhE#fF#I n# p#e - e# ref!#R74w xR#Iye#`z0# x {0#b&|0#r}0#[ ~0#=0# -0#$uX#( h n 2Lq40Ys7 ~Y p#$/Lf ##  @)#!#@# P w#ۉ#X ܟ## E ) -C% - =># / #  # 6  # # # O# # z# #$ #( #, =#0 #4 .>#8 >#< w#@ o"L#D #~#F $#G b(#H {1#L 7#T ;8#X [:>#\ !<#`dk T##2 >#J  C  3   b #  6   ] #  #  # bit >#u32 "0jZ *_ +# key ,6# H 0 wq 1A# rq 2A#v 3>#0 4>#4 50#8 6#< 7#@ 8>#Djn(8Hv I0# J0#RK# fdL># =M0# expN0#3O#4P#w3Q# $4R#$ ibS0 #( obS0 #,b T0#0U#40 S= }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0W 0#4 >#8"(  #< E#@ E#A e#DJ #La #P % #T + #X_ . t str u# len v>#p p 0 v  Z  zI e#L e# #$ # fe *# be *# ># = >#$. 0#( req 0 #, rep 0 #0 si 2 #4 ## # P# srv #3 #A #. B # txn j#r ># m# T #0 k # …# Å#  #{ 0#_  < ]e +nk  #!e # u k a uid^&# gid_#\`# buxau  $ L fdM>#v N>#+O>#A=P #  Q #lR>##S>#T0#UU #Ve#(W #?X#%Y ##Z#W [0#b #u(c# TQum #n>#-o>#p># q# r# s>#$Q3t #(h4u #,v #0cw #4>x #8y #<?ze#@<{>#HI|e#L   >> >  >  C fA # bB0 #} ? cbC}#RD#v EE# evFE# G#H#  p7A=4un5< in6Pp2 u7#' N##>#^# e#k a^#_%#B`%#a8?+U,#-#.>#/h# v k{ ##'L "8len"90#cr":0#U";0#% "C v"D#[ "E#`"F#("G#2"H#  !   a        . !J! l!># m_l!># u!># u_l!># v!># v_l!>#! l!># v_l!># c!># c_l!># r!># r_l!>#!rq!st!JdD!: !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!d# sl!# | !e#8!>#@!1!#%!L# !6 # req!# rsp!#\ uri!# !#!#nG!>#=!0#?ZD 0#V 0#0#*>|HUI#v J># K>#vL># M># N# O#&Q*#R># S>#$ S>#(#T0#,6T0#0dU>#4 U>#8V>#<KWe#@ X#HA=ZP#L3[P#\{=]P#lo_>#|o`#@b#b#c#_ dP#Ne#f># g>#;g>#"h># h>#h>#i>#j>#Fk># idm#n0#L n0#o0# p0#Oq0#r0#Vr0#gsA#v t0#hu#ww#ww#Zx0# y1#{w#{w#|w#|w#}w#~# 0#w#~ w#w#%w#,>#?*&hDQp # #)#v ># +>#I>#\>#P#q!#, acle#0]e#8e#@e#H<!#P srv#\9 >#`) >#dR 7"#hU#J #>#c#>#0#>#>#K# >#& >##>#>#y#1 #R>#>#S,Է###>#Ze#%8## id#Ke#d># >#d>#0#w0#\0#0# #0## 0#w#Xw#~ w##0#}0#70##N##h##` >#(#>#0#Z0# 1#w#w#w#w#w#w#  w# w# %w# >#cap># 3P# {=P# o ># o # U *# A  # I  # J ~#  ~# J># R># ># ># ># q># p># ># D # n# ># 1># ## 4## 2# 2# ]2# {## } ## ># a # ># ##   ># w!># "0# #0# $ # $ #Hm%  I e# !p # srv "# D  >#z <# <#  <# 7#s 7#  7#$$ ^#(Q ^#,( ^#0 w#4% w#< px *# sv # ȅ# ȅ# = 0# iid >#G ># sid >#  ͐#  iid ># px *# buf 0# sid 0# ptr ># bol >#2  >'  Ε ֬ B  6T p H k p Z G L ,z{# t0|# t1|#7}0#U~0#># >#$>#(q!<# len0# pos0# sid0# srv# oe*# src # buf+ #!be*u! 0#<e#!  srv!# >#v >#"X actx # bckx #,7" act# bck#&#>#% ># >#># >#># ># # map!# !#,F"#> 2##62##u72## 2##2##2#&## >#1>#Q7>#9># *>># >#3># >#S,# # # #6 !`$C2pU"u"[ 0V"=0#C2S#G2R#)W$& 0%$ DpU#C>#G2S&out'!#(R#UV!$CUlU"CT2S(retVP)5%CjpU"Ci2V#(kP#UkS!o%C U"C2S'!$j)%C  U#G2S#x ^V#`^W#C>p*2%* %*&%*t%*u> &+ *#Q &#Ce(nY  4D A@ <7<&SBint3CzDHAIFSz Uz %j  Dh E#f F# $/ 36f   # 6# F ) -Q% - =h# / #  # 6  # # # O# # z# #$ #( #, ="#0 (#4 .h#8 h#< wo#@ o"3#D #Z#F $.#G b(>#H {1#L 7#T ;8#X [:h#\ !<D#` d"k T"#(#2 h#Q >  T 3"n(8Hv I%# J%#RK# fdLh# =M%# expN%#3O4#4P4#w3Q4# $4R4#$ ibS#( obS#,b T%#0U#4..T" S= }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0W %#4 h#8"( #< ,#@ ,#A A#DJ .#La .#P #T #X:Z  ]hhC fA# bB#_ ? cbC_#RD#v E,# evF,# Go#H# o  ZD %#V %#%#UD %  UctrR!%VPD!%Qage"%P  ,6uACD-%a,%b,%D:% f Uctr9SKD9%Vf9%;%QPD;%Rage<%PG Q ,6S#DX%p  UctrWSKDW% fW%Y%QPDY%REZ%ageZ%P  ,62`F `tuh  Q :%!now <b:[.  D Aint@ <7BAI b#k y  ]# # # bit3# D  U _W Z l "e R      +7 T  f   +7 s   T7 < f A C +7 'sI L  @TQ T fQsY \  vss v s   D_DD%D%D%DD D DDfDDtagO Jy3sD3fDlD tagO D . UsubnewV ~  W("R&2 .s  C  CP Z  + qs  @"Q T  fR   +7 s  s  _Dsubnew<cD~D_D_uD_ P(!D3 W\X0 E Aint@ <7BAI b#k y  ]# # # bit3# u32"% s32#3 ;Z* _+#key,#oEo0  U unewo .{9  pX"VlShT  f"&2      P_"  C O ?  NEo unewooldoD%fD\ExE ~DD uD ,E! ~DF DF uDG SEG!"ret]N #Du$fD%tag &y&3#lD$ %tag &#rE 3%x 3"r 3#eEo U unewo # S5pAq"MVYleSqh}dT  f"08AEP#sv#cEo$ u%newo"oldo D% fD \E3 xE ~D D uD ,E! ~D D uD SE!"retN~ E#o{U "uPx"Vj~'#SPRTfE{o zuxz_|ofD}y~H7E(oU 'uPx'V4HYd'P#mSxPWRTf5Eo ux_ofDkeyy3DE1o U 0uPx0W_2o(fD3VT69f3APM3APM)N$)$D%^`E A@ <7<&SBR2,int3CDHAI %<3=%) -w% -=s#/ # #6  #  ##O# #z# #$#(#,=#0#4.s#8s#<wz#@o"3#D #Z#F$#Gb(#H{1#L7#T;8#X[:s#\ !<#` dk  T# # 2 s#~  w  3 $/ 3&f   # &# 6 q4%7 6gY  pA#5n(8 H v I%#  J%# R K# fd Ls# = M%# exp N%# 3 OG# 4 PG# w3 QG# $4 RG#$ ib S#( ob S#, b T%#0  U#4AAg5  S = }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#, %#0 W %#4  s#8 "( #< ,#@  ,#A A#D J A#L a A#P  #T #XMZ  ]ss C f A# b B#r ? cb Cr# R D# v E,# ev F,# G#  H#  x== =>L# :<?#<FGA=H=I< B opD# vJ#E"s`Un=#hfd$sP#__s&Su&&%&3&,__u&__c&aK2  t us  Q;`2L`E A@ "%<7<&^Binto6%>:G?:)A:3CDSAI % 0E"fd#s# F$l# E%l#7 RJ |GR# b0 ?J;IB+GQ/ 3f   # #    ) # ! z#  #  w 23q4%Y$7 /kY  pE# ڎ# :# X P# # , ) -^% -=s#/ # #6  #  ##O# #z# #$#(#,=#0#4.s#8s#<w#@o"3#D #e#F$#Gb(#H{1#L7#T;8#X[:s#\ !<#`dk  T# # 2 s#k  d  3 b#  W ]### bits#u32"%Z* _+ #key,W#In#p#1 H0wq1b#rq2b# v 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA174w x^# Iy# `z%# x {%# b&|%# r}%# [ ~%# =%# -%#$ u#(  n(8H v I%#  J%# RK#fdLs# =M%#expN%# 3O# 4P# w3Q# $4R#$ibS% #(obS% #, b T%#0 U#4% S =}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 W %#4 s#8 "(H #< ,#@ ,#A L#D J#L a #P T #T Z #X< < % B Z + N k ] +n k  # ! # k auid^#gid_m# \`x# buxa  $ LfdMs# v Ns# +Os# A=P# Q # lRs# #Ss# T%# UU # V# (W # ?XG# %Y # #Z# W [%# b # u(c# TQ um # ns# -os# ps# q# r# ss#$ Q3t #( h4u #, v& #0 cw& #4 >x& #8 y& #< ?z#@ <{s#H I|#L   ss s  & s  M CfA #bB% #  ?cbC # RD# v E,#evF,# G # H# ,  <] #^# >_ #set` #clra # q?b # >c #remd #cloe # f3f # 7g#$ r@h#( $i#, Ej#0 uk#4 ls#8 s s s      s  s   @p7A=4un5k in6kYp2u7# R Ns# Os# +Ps# Qs#  ;uids# #?s# @s# As# Bs# 8Cs# \Ds# ?Es#$ Fs#( G#, 'H#0 JIs#4 Is#8 JJs#< RJs#@ Ks#D Ks#H A L@#L I L@# RY# S # cTs#G>*s`Ufd) Rdir)sQf +P{?/sUfd. Pdir.sR?5sUfd4 Pdir4sRl?;sUfd: Rdir:sP!retDs@UfdC PdirCsR!retEsP"# FP#~>M@dUfdL P#>VpUpU expUs nGWsp!fdXsS EXsl EYsS!fds[sh [sV!sr\sP!sw\sR!rn]%d!wn]%P$G# P%b) P&~v''('')ks*js+nowjs)&s+nows+exps;,?siUp V,5?5,>F,EW >sS#]>pUp S>sUp #J?LU!p R-2- -ps  -r-tM -us !. - Q- ;%-W-s-Q%-R%-U%- VM- Wb  b $? F!tb PF A@ "%<7<&^Binto6%>:G?:)A:3CDSAI % IB+GQ/ 3Of   # O# _  ) #! z# #  w 23q4%E;LY7 Y p#H##X #H# X, ) -c% - =s# / #  # 6  # # # O# # z# #$ #( #, =:#0 @#4 .s#8 s#< w#@ o"3#D #e#F $F#G b(V#H {1#L 7#T ;8#X [:s#\ !<\#` d:k T:#@#2 s#c V  l 3 b#  l  ]t# # # bits#u32"%#Z*_+#key,#HInH#pH## H0wq1#rq2#v 3s#04s#45%#86#< 7#@8s#DN~74w x#Iy##`z%# x {%#b&|%#r}%#[ ~%#=%# -%#$u~#(  \n(8 Hv I%# J%#R K#fd Ls# = M%#exp N%#3 On#4 Pn#w3 Qn# $4 Rn#$ib S#(ob S#,b T%#0 U#4hh\  S= }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0W %#4 s#8"( #< ,#@ ,#A L#DJ h#La h#P #T #XtZ   ], +nk  #!, # < ko auid^#gid_#\`# buxa<  $ LfdMs#v Ns#+Os#A=P_#  Qv #lRs##Ss#T%#UU| #V##(W #?X#%Y ##Z#W [%#bo #u(c#v TQum #ns#-os#ps# q# r# ss#$Q3t #(h4u #,v #0cw #4>x #8y #<?z##@<{s#HI|##L   ss s  sv   CfA #bB#D  ?cbCD #RD#v E,#evF,# GT #H# T &9 <]#^#>_S #set`S #clraS # q?bS #>cS #remde #cloee #f3f # 7g #$r@h #($i #,Ej #0uk#4ls#8N sN s s9 e N Y | | sZ k  s|   |   p7A=4&un5 in6 p2u7 #2RNs#Os#+Ps# Qs#  ;uids##?s# @s# As#Bs#8Cs#\Ds# ?Es#$Fs#(G#,'H#0JIs#4Is#8JJs#<RJs#@Ks#D Ks#HA L #LI L #R # S #cTs#>ptr:fd;su32<u64=E 7F8#>#F*F+%#fd,%#TF"sPwU [ "sS!"S>UsU"fdTN Q"dirTs #"WFgU$ofsh!qFisQ!FjsS!UjsR%chgksp%fdksW&"Ap'3S(>(H'RV)Lp*]S+iF#s,=F#s-op#s-fd#s,/F#i.#/FU"fdN Q xFsS%ptrR?s5U"fdN p"dirs %ofsV!FS!xFRl?s@U"fdN p"dirs %ofsV!FS!xFR/>U"fdsW%ofsļS/hF;U"fdsV%ptrԬP/>@U"p| "expsS.nGs%fdsd!sp!Esl0j'S'Q(()*W0((&(!(,+E$s,=F$s,F$i,F$s,%$s.$+ks,js-nowjs+8&s-nows-exps1,?s MU2p| V3F33F53LF73F935F<34>sS5>FPU2pE| S1>asU2p`| 6fdbsP1-Ers RU2pq| 5QJ?`U6p| R72^X7 ^7ps Z 7r~7t 7us 8 7Q7;%7W27s7Q%7R%7U%7 V47 WG!BF/s!!F0!F1 !$?;!F>i!F?s %evD$ s !*Fc0nceQ(F A@ "%<7<&^Binto6%>:G?:)A:3CDSAI % IB+GQ/ 3Of   # O# _  ) #! z# #  w 23q4%E;LY7 Y p#H##X #H# X, ) -c% - =s# / #  # 6  # # # O# # z# #$ #( #, =:#0 @#4 .s#8 s#< w#@ o"3#D #e#F $F#G b(V#H {1#L 7#T ;8#X [:s#\ !<\#` d:k T:#@#2 s#c V  l 3 b#  l  ]t# # # bits#u32"%#Z*_+#key,#HInH#pH## H0wq1#rq2#v 3s#04s#45%#86#< 7#@8s#DN~74w x#Iy##`z%# x {%#b&|%#r}%#[ ~%#=%# -%#$u~#(  \n(8 Hv I%# J%#R K#fd Ls# = M%#exp N%#3 On#4 Pn#w3 Qn# $4 Rn#$ib S#(ob S#,b T%#0 U#4hh\  S= }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0W %#4 s#8"( #< ,#@ ,#A L#DJ h#La h#P #T #XtZ   ], +nk  #!, # < ko auid^#gid_#\`# buxa<  $ LfdMs#v Ns#+Os#A=P_#  Qv #lRs##Ss#T%#UU| #V##(W #?X#%Y ##Z#W [%#bo #u(c#v TQum #ns#-os#ps# q# r# ss#$Q3t #(h4u #,v #0cw #4>x #8y #<?z##@<{s#HI|##L   ss s  sv   CfA #bB#D  ?cbCD #RD#v E,#evF,# GT #H# T &9 <]#^#>_S #set`S #clraS # q?bS #>cS #remde #cloee #f3f # 7g #$r@h #($i #,Ej #0uk#4ls#8N sN s s9 e N Y | | sZ k  s|   |   p7A=4&un5 in6 p2u7 #2RNs#Os#+Ps# Qs#  ;uids##?s# @s# As#Bs#8Cs#\Ds# ?Es#$Fs#(G#,'H#0JIs#4Is#8JJs#<RJs#@Ks#D Ks#HA L #LI L #R # S #cTs#>ptr:fd;su32<u64=E 7F8#>#kGe%#s1%#RFEs7U[ EsS ES!uF@U"fdN S!uGU"fdsS#pos%V>sU"fdN P"dirsQ#retsP1?s U"fdN S"dirs $Gj#i%P%?s U&fdN S&dirs 'G(i%R)>& , U&fd%sS)hF00 O U&fd/sS)}>9P %U&p8| &exp8sp*^G:%D*G;%H*nG<sl(eo<sS(fd=sT*qF=sQ*>sh*9G?sd*E@sW*VGAs`' G(f +#*)OsW,}!"-S-Q../!"0\+ #(esR,3##-S...1H#$0S,d.%7%.$./2;D%I%.L.W3EGs4=FGs4FG4FGs4%Gs5G3FFs4=FFs6opFs6fdFs4/FF5F3;ks4js6nowjs3c&s6nows6exps%,?2s%&U&p1| S',GLd&'LGNv&'FP&'5FS&)>]&@'U&p\| S%>ts@'h'U&ps| (fdusP%>Esp''U&p| )bJ?'Q(U(p| R72oX7 o7ps Z 7r7t 7us 8 7Q7;%7W27s7Q%7R%7U%7 VE7 WX Gs8 Fs@ Gs< 1G0 BG4% FL FsP#evTK>hcnPGintAI@ <7<&dB3C/DYA6 ) -G% -=!#/ # #6  #  ##O# #z# #$#(#,=#0#4.!#8!#<wy#@o"D#D #k#F$#Gb(#H{1#L7#T;8#X[:!#\ !<#` dk  T# # 2 !#N 6 G 6 3GI!GJ(GMdGNRGGG  $GElowE#GE#CPsNllOGP$9GgPnUnfVWdfPQ'9dKU_$judtpVRWlhWPQ0$ RPP#GUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Gm1m0 C!2;! ;\iBpGintAI@ <7<&dB3C/DYA6 ) -G% -=!#/ # #6  #  ##O# #z# #$#(#,=#0#4.!#8!#<wy#@o"D#D #k#F$#Gb(#H{1#L7#T;8#X[:!#\ !<#` dk  T# # 2 !#N 6 G 6 3GI!GJ(GMdGNRGGG  $GElowE#GE#CPsNllOGP$J/H[pBUuZvZPQw\pJx{\fplH${`VW\DRPPXT8p$P'L P4GUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: G!m1m0"C#2L# L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$.? : ; @ %.? : ; ' @ &: ; I ': ; I (.? : ;' @ ): ;I *4: ;I + U,: ;I -4: ;I .4: ;I/ U0111213.? : ;' I 4: ;I54: ;I61 7.: ; ' I 8: ; I9.: ; ' :: ; I;.: ;' @ <.? : ;@ =1>.: ; ?.? : ;' I@ @4: ; I? < A!B4: ;I? < C4: ; I? < D4: ; I?  E4: ; I?  F4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I  : ; % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I %4: ; I & '4: ; I( : ; ) U*1+1,1- ..? : ;' I /: ;I0 : ;14: ;I2 : ;3 : ;I44: ;I 51 6.? : ;' I@ 7: ;I 8 U941 :.: ; ' I ;: ; I<: ;I =4: ;I >41?.: ;' I @: ;IA4: ;IB C4: ; I? < D4: ; I?  E4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' @ #: ; I $%4: ; I&4: ; I '1(1 ).: ;' *: ;I+.? : ; ' I@ ,4: ; I - .: ; I / U04: ;I 1 213.: ; ' I 4: ; I5.? : ;' @ 6: ;I 74: ;I 8194: ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' @ ": ; I #1$1%.: ; ' I &: ; I'.: ; ' (: ; I).? : ; ' I@ *: ; I + U,4: ; I -4: ; I .1/1 0 141 2.: ;' I 3: ;I44: ;I5.? : ; I@ 6 74: ; I84: ; I? < 9!:4: ; I? < ;4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; ' @ : ; I : ; I 4: ; I  4: ; I.? : ; I@ .? : ; @ 4: ; I.? : ; ' I@ 4: ; I !.? : ; I@ "4: ; I? < #4: ; I?  $!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I % &4: ; I ' U(4: ; I)4: ; I* +4: ; I? < ,4: ; I?  -!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$!I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I<4: ;I =.: ;@ >4: ;I?.: ; ' @1 A.: ;' I B: ;IC : ;D.? : ;' @ E4: ; I? < F!G4: ;I? < H4: ; I?  I4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I? < $!%4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.: ; ' @ ": ; I #1$1%1&.: ; ' I ': ; I(.: ; ' I@ )4: ; I *4: ; I + U,1 -: ; I.4: ; I/4: ; I0.: ;' @ 1: ;I 24: ;I 34: ;I 4.: ;' I@ 5 : ;6 U7 84: ;I94: ;I:.? : ;' I@ ; <.: ; ' =.? : ;I@ >41?41 @ A4: ; I? < B!C4: ; I? < D4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I $ %4: ; I&.? : ; I@ '.? : ; ' @ (4: ; I)4: ; I *1+1,1-1 ..: ; ' I /: ; I0: ; I 1 U24: ; I? < 3!44: ; I? < 54: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ;' @ ": ;I #.: ;' I@ $4: ;I %4: ;I &1'1( U)41*1+1 ,41 - 1..: ; ' I /: ; I04: ; I1: ; I24: ; I3 : ; 4.: ; ' 5.: ;' I 6: ;I7.? : ;' I@ 8: ;I 94: ;I: : ;; U< =4: ;I> ? @.? : ;' I A.: ;' @ B4: ; I? < C!D4: ; I? < E4: ; I % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( " : ;# : ;I$!I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F.: ;' @ G4: ; I? < H!I4: ; I? < J4: ;I?  K4: ; I?  L4: ; I M4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I < !.? : ; ' I@ ": ; I #: ; I $4: ; I %.: ;' I@ &: ;I '4: ;I (4: ;I ).? : ;' @ *4: ; I + : ;,1-1. U/41 0411 U21 314 5.: ; ' I 6: ; I74: ; I84: ; I9: ; I:.? : ;' I@ ;4: ; I? < $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' I@ #4: ; I $1%41& U' U(41 )1*1+1 ,.: ; ' I -4: ; I. /: ; I0: ; I1.: ; ' 24: ; I34: ; I 4 5: ; I 6 7: ; I 8.? : ; ' @ 94: ; I? < :4: ; I?  ;!<4: ; I? < =4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I3.: ;' @ 4: ;I 54: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH4: ; II J.: ;' I K : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #1$1 %.: ; ' I &: ; I': ; I(.? : ; ' @ )1*.: ; ' +1,4: ; I? < -!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!< "!I#.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; < !.? : ;' @ ": ;I #.? : ; ' @ $: ; I %4: ; I &4: ; I '1(1)1 * + U,4: ; I- ..: ; ' I /: ; I0.? : ; I@ 1.? : ; ' I@ 213 U441 5.: ;' I 6: ;I74: ;I8: ; I9: ;I :4: ;I ;.: ; ' <4: ;I =.? : ;' I@ > : ;?4: ;I@.: ;' A4: ; I? < B!C4: ; I? < D4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; @ " #4: ; I$ %.? : ; ' @ &: ; I ': ; I (4: ; I )4: ; I *4: ; I? < +!,4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #4: ; I $4: ; I%.? : ; @ & : ; ' U(4: ; I ).? : ; ' @ *4: ; I? < +!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < , src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hdd9,V # +9,VV9,Vj:Ve%9^a;dKY#lq [a9+V0co>l 9x3xA̎WVVVVVUrVGr<:t q՜hȎWr ՠIdVH,KX|:f.d)s*~ Ȃ~MGsuOf,9T9,9T{ c&9V*9V9*9Vk(9X9(9XzkkUTnU 9PDSsGI&d8H~c@999H cU"G2yG~c~+~93xG~c~+~9@c~+~9Ve9+~UVUrwUV~9 G wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrddWƸ~.7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+t<7e5=D-8Vz9W=scW)-b Ȏy9.yqn=5=+nU  ;%urrVg ׀8Hdh  8rr0˸V-rsU s csU+rd5 (V8:VXYXWW~ V^<d32R<RYU9U#rqq4q~9xU gVU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.hGHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊh srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.h`Ud8,J:,1|8,YJJ:1n8,fe$f͓8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8,< src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h0;|t*:V*,:eU,I;,qs{>>V: fsU *rey2GdT԰GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ:*J:8dede9 9W/ctGwӏuUWHs~G*:5rU)t4 9t+0Vrhd*: 5/~:U@y9>l?rqd++rcHsVrxncre cƒ+,cV qw3W<ude ~+~+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg*h:*IH,l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.hpd8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӑ5gd;6d*GnX<;)-a;,HVVW,t #z+fm;)-a;,HVVW,rc%#z+<`>jXr;)-a;,HVVW,t oc:8HY5hdnf%V;,sHzU c, ye,H srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hfd.hglobal.htime.huŪ~|<:;juŪ~<,;iG R<:;XRh@XRh9 tq9c">T:;)Wcgm:drwJ,S,Wuc0dpH Tf#~9T(\x9#W2--Ӡ:Rt:s;a;H`I%;hAUdU 7WU v<8:j"Gcc9dbdg+$9X)pE srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.hG GfU9aG@y+@ GVeuA%GdS;Td;tr*d,fwq>qQ=:`G,+hUzG?|G+ Gk+~U=zU9+h+zG?}Ge9+sY*GVobqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:m2 src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cstddef.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.hP$q:r7XG U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV j src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,"/ src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hgrp.hcfgparse.hacl.hstat.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h`0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@Us)L#*&TI* $:p: +7,::7; +s+\qH st-fr-GJ##Ic|qՆ(*r=~qՆd~ՆwqI%*r=ov  GG GG-GNe70b9fb9geDdce70b9fb9geD(eZH7ddrC(eZH7ddr'(G(AHg5g6<6Xae-bd,.d9#*:e8]$*:f6f7d,8d8:VHL wUbd.n9$*:, %#*un+*|s*+,xr GH#*&TI* Gd v+uqՃՅr_r$ cv+K#*W vq G G GHv uqrWyH H#*^1&*s +scj+ rdHr  GN#* cy9=`V;=5fV7rd cw9 c8,rc r+9 q~cr9~&rU rU ciMqd9y+}}d9~$# #qq-dde U:8;7:1 9w9dtn0t+9If ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d l  srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hfd.hglobal.hstandard.htime.hsession.h9:iEas,Sd=cc~'$#sv, G~,~qVUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zq<D%Vq 9t+ cK~HM1>yq~+ )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`G{:n+qIł|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcyqO92+N+4+L+1yN+6Gc9~zdH-,8: zcdH-,8:,pyY+~=qyqyqczqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd 8  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6:7/JU,k}qr:T:ckDGI7-v::8e :rt:/V8:a:[r8k>rV%+8d}I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎W:vqe 9vUd X+Jr~:b:;7:,`:b:;7:,iwUA+T:8:'Xb:8,d$ ~$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^!Gy+ %z_S9-9S+-9!9^!9^!+^U!+^9!9^c!+^q*r!Vi8rV8:H:8dqUA+l 4'4dpUdjmUY*Gcooco95c,6rsԀd Ŏ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrkmY*G~c+~++vGE +c7-UmqRd`c`U q_9 G_9 9H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrilvq qm?z9hUhqFq:9q9 V;%;8pHZ,@y+@y9@⎸d :pyH=53x9<Tld28,.78;+ wU5=g*Z}s 9s9: qV;V:jy9@⎸dd8y+d8 UVd[<6/540l=d:8eaX++t+;7db 9t+ 9'xq 9z9ccc?c9c+9cqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU K srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hfd.hstandard.htime.hglobal.hproto_http.htask.hYPAh cv9 9v+ Śft)rrc~f9ecn[*dd;m9+x~?z9.ԜhG:IGHdHw rtc + :8,H:8 9w+dp@(deU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95dVr8;lU6;HddH40P GǙfrrdpVsy92vU=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f|GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:Z9&9H8,8:^>:8:Up9t ;I7; 9 +t9 +w,V:=C/:0,=5)$ӎ*=8z9*J`t%+`,W-+RFrJvGdr)+ VH:T1:*rt:8: 50Sq:qtf-rs:<6<`VdƸ6fKdQ!i x]:rsv9 +uqJsgV|W2rsl9+kqK8cuG cfVu)LwUcrs 5/lJ8V1rs 5/lJ8V+d b srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hfd.hstandard.htime.htask.h*@c+9Y9*GBc,'XY9:rs G;q<7snssdyU<7snssdAUT Gq:Y<7snssdUU++:*dvGE++9vGR  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hfd.hglobal.htime.hpipe.hsession.hcfgparse.hP;STd8d"؎8Fe/Sc+V98&U`95 ,=\92~=pcU!8,aUGG~d9~,v2c/S9-9U5x+j`% Ud m@7zq:9{U@++o+[| $#zc 'Sg o,8[?W 9%'d*i>4}0v+u;d8J<:pg5=,;+47-*}FY,8E 9F#-K T̎*#U&F L IG *$*J&~c:plA3;d*?:c 9RL,b9N }<Gq~G~d*- ~zlis#/dK|+|Uq}';sdȓ97*}cq}B-G0zc?H+@4> +*ed Gd q:*}0+|9}}lish ϒ$izd Gzd G+UgIGԀ*V+*e++9qGHR:6<~nsxw+~cV '$ 8'$ 0 3v' U#'>8zwwzzwzzP=<Gw=<Pe7bd~:b,+s&67e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g= m <9,+ 9krI+v9 qd  srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hfd.h standard.htime.hglobal.h task.hcfgparse.h@)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#,~qVUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#ӏ)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~+9~9+~+  9D}]u!GN4vpI:p 7-TIX  ū;7;6<?|&8:8&:XW&|Ub,9UlU*A᠎|q8:8F:|8:8:8'|:*9d0(:p-V q=,::7VV Ursf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzcdH-,8:xdH-,8:,p{rdT:Vrsb~~q9z%W+e6} qxu{qJy=:LGr c}h9Ǝd-H?:?zzGGr~bdrds{3r}dԀd9e}H  +<dyƨ_cf)w>9B9 n f99b 8V1c7s O197e:{|dqY*GdUY*GhY*G_:qY*GdUY*GhY*j~HkH~Vkez?wqx6qq6|q#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.h`&9::8:-J:8:-JG;#HII7;HI<b+:x usU 9T,T,+d8))-zc1s8XPYMG f *[crH8:+(BrrP>8dtXX RGx*srb:ddS-  `.Wgrtrrrrrrrrr srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd:GH-, GdwɜQ 9vJZerUy+ru;xc^0rƎsz Uy+p srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hstandard.h:9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.h0 yqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.hpoll.h`)9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud +8:)WWS;|;);Wl9_:Tif9i9 8,*z9+P>TfEt6XJX R Gz*srT:ddS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hP!G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;HrtzU?HXr q~G,as@d-rrcilqp~fG~q *G GP>pdWJ6XX8VJ8YRGu*s[,GHW⸸dzk9.*IV 9,e `.*Krtrrrrsrrr srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hG,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9r*:7W+,V Ӓ )7W=7+՜|4f9 q/R<bbc"~W;S/; 7W,}9c}UGeVeVV@p+&:T}f9}9 T9`Gq9q>ae6XJ8YRGfGr,fq!rT:dǸd39.*IV 9,e `.*Krtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.hP}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8. '.). .). >.$@ .P)l  b.. 5..4.. .*.{..0.. 0.. ..  ..  .i. ..0. K.g. .. ..  .. Z.M. .. }.6. .*. .. J.z. J.z. .. .X. !.?. !.. .. .2. *.Z. .. .R. G.o. .. ._. *.. +.!. .7. p.. H.. H.. .. 5.. d.'. '.5. '.. L.. '.. 7.. 0. . .+. .(. .. '.U. *.U. *.2. *.i. c.X. '.t. <.i. 9.i. <.m. '.e. '.. '.. '.5. '.{. C.L. (.H. '.. .. '.K. <.m. '.j. '.K. C.`. 0.+..o..q. A.N. J.\.  .. ..  .hi  '...G . -.. .. .Pz pz | z: zR | 400{j !.8. 00{ 8.400| 7.`0| E..D. Q.0.V.N.  .X0~6 ..D. \.3.S.,. X0L ..D. \.?.6.  .T0- ..D. \.'.6. L0@ ?... .[.<0`h W. -..0Ї . .=.g.t.J..Y.. .R... .. 80T g..| (" $"(  ."} 8"0 .:.8" _  ..," .| 8#`` . ".t#  .?. ].. .m. ..0#..C. #PJ #S ,#| ?.,#{ ?.# $#  .| %@7 %* T% .... @.. .D%Y a.Y. .B. T% <.5.... .0%z ".l%pJ R........(..L%  _...=..H%` .%. ... ,% .,%S .<% [..d.|%5 .J. ...  . . ... )..t%0g  .2. ... 3.l....  .$% .| )Q p) R  . K.........<)  ?...0)  U.0)` .0)  =.0) : A.$)` .| 4+9 ..0+t  .0+@c .0+ /.(+@\ 8+ ^..4+0+ . . 0+` .$+@E (+a (+ <+  .n.3.X+p. 0.....2..D+E  w.. .. 0+ .(+ (+@ D+ .S.:.a. 8+0 G.a. 0+$ .8+0 . .8+  R. ..0+ .4+` %. .<+ . k.. L+ b. .. 8..0+ Z.X+@ .. .. L.. -.0+ I.X+t  .0. .&. .. .<+  . .. L+@ [. n.. 5.3.0+ U.<+ E. &.*. +0  G.F. G.Y... .R. !.. . . j. .W. m. .R. g.;. ].<. T+0"~  ..F. ... S.0. J.l.*. .d. .. .P. ^.Q. q.-.V.. ].. s.^.t. *.k.Q. .. N.b. ... ..F. .I. =... v.<+;\  ..&.+<D ,+`<o =.,+<A  .(+ =Y (+=Y (+=e +P>: ,+>s 5.,+?v 5.0+? *. ,+@@E ;.,+@? 5.0+@_ -. ,+0AE ;.,+A? 5.8+A *. ^.,+pBE ;.,+B? 5.(+Cd $+pC .| (9CC D9CL M. {..H.,90Fx I.<9Fw . w.1.,90M 8.D9M E.Z.L.n.09P 1.$9pRj '.09R .| $;U .<;U) %..P.0;WJ .$;PX& .$;XM ,;X .| (<Y <Z <P[A (<[r (< \n <<\0 ...0<]A $.0<_ x.0<_ u.(<a (<0b" L<`c  . .{.'.r.,<ec %.,<`f .4<Pg . .D<ph $. .B.0.,<@j .8<`kF  ..<<l . 0..8<`o W. f.|<p6  2.\.U.E.t.l.%.+..<.;.0.,<yt O.,<@{ c.<|  .x. .g. @.. 1.=.&. L./. #.d. ..=.[.0<`D <.<; 0< .0< 5.0< 5.0<` 5.0< 5.$< .| D- DЌ* ,D .,D .| 0DP  R.$D .HD0O  .. .4.0#.. .... ..@ ..0.X. ..pF. b.=.0./. .-. k.T....l. #..0#..@4. L.t.p...LD ..`J.5. .<De 5..` .,D9 .D@ . '.\. '.T. Z.p. D.!. -. .;. B.?. #.. D.XD   .). s..0+..@.$D  .| <hH@ f. .S. LhH  O.F. v... 0hHT .hHPQ hHQ 0hH\ m. hhHp .. W.K. .9. =.[. .hH+ (hH $hH6 .| ,J{ _.8J` ..$J? #.(J0 0J C .0Jp/  .0J }.LJ .6.t..t.J`o J| ....$.I."..*.U.Q..2.G. .s. .H. .$JPp | (LM | M`$ M  M  $M5 $M0 M@$ 8Mp . .,M .,ML  .M   M0 | $LOC .,LO %.4LOt 5...0LO0  .| $P $P0 $P  $P@  $PP  $P` ,$Ppc ,.4$P *. +.,$PX !.,$Pe &.0$Pp [.0$P0\ .$$P .$$P .($Pm $P@) 0$Pp=  .$$P  .,$Pd  .($P04 ($Pp. $$P+ .$P $P 0$P@ .0$PP .,$PL .0$PPa <.<$P .X..<$Ppc ./. .<$P  .k. .<$P !.. .0$Ph +.0$P  .8$P . .($Pp; $$P .| 0V M.,Vp Z.8V\ .#. .,Vp4 .,VQ  .<V  .R.0D. | ((X O ((X F $(Xp S | (X  (X  | 0(Y0 _ .0(Y n .((Y{ ((Y ((Y  | 8(Z .1. .| xZ`$ xZ  xZ  $xZ5 $xZ0 xZ@$ 0xZpL .,xZ ".,xZp@  .xZ  xZ | $0\P' 0\" (0\ ,0\? (0\U (0\@X (0\N (0\K 00\@ x.,0\ - H.,0\P .$0\( .,0\ 2 ..0\` | $^' ,^@J ,^P ^2 (^ t (^c ,^  .$^0  D^P Q ..O.D.,^%  K.,^&  .$^@'( .,^p'2 ..^' | (0aP | (pap totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavailsrc/haproxy.c__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconndo_logre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_addcookie_strprev_ctrhash_listfailed_secualgo__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlennb_taskswmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbnext_svidgracepool2_requrinow_msnbbeuri_len_limituri_dirs_depth1node_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addfbckhh_lentv_acceptHTTP_METH_HEAD/data/git/public/haproxy-1.3/branch/masterto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyusagefastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tlogssrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headl_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lenconn_retriescallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognamedowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authstats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_nameout_realmstats_add_scopestats_check_init_uri_authstats_set_realm__lenout_base64ulistnew_nameout_ubase64src/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstrl2llrcret_valomultidivstr2saoctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrnbloggerssess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitysend_loglogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifset__tv_isgtmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollernbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_inithex2src/regex.c__resrm_sopmatchcheck_replace_stringregoff_told_dstregmatch_tchain_regexrm_eomatchesexp_replacehex1warnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listproxy_type_strst_sizeatoist_blksizepw_passwdcurproxyconfsectst_gidrangeproxy_reset_timeoutscfg_keywordnext_pxid__s1warnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalinit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkpw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bcktick_addattemptsout_errortask_newprocess_chkfd_insertpc_endevent_srv_chk_rpendconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledsrv_was_pausedout_wakeupstart_checkscheck_for_pendingset_server_upout_nowakeset_server_enabledredistribute_pendingset_server_downmininterevent_srv_chk_wlskerrsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrc/queue.cpendconn_get_next_sessprocess_srv_queueratioinit_pendconnsrv_dynamic_maxconnpendconn_addpendconn_freependconn_from_srvget_frt_addripv4out_fail_repacl_fetch_dstacl_fetch_dportout_fail_idxacl_testsalensrc/client.cmax_setpatternsacl_keywordout_fail_rspcapout_free_sessionmin_setfreeptrbufupdate_freq_ctrfetchout_closeout_fail_reqcapbuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskladdracl_fetch_dconnmax_acceptacl_fetch_sportout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosemaintain_proxiestick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsdestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_reqcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxhttp_msg_oodhttp_msg_rpbefore_crdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdrbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookielocal_asessionpathlenquotedhttp_msg_rpline_eolacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverasession_temphttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenret_ptrhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptrhttp_is_tokenauthenticatedhttp_find_header2http_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirecthttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcodenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrhttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupappsession_refreshinitializedhtblelementses_msizeidlenappsession_initkey1key2appsess_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_errprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queuemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serversrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serversstream_int_report_errorsrc/stream_interface.cstream_int_retnclosestream_int_returnbuffer_abortstream_int_check_timeoutssection_typesv_statesrc/dumpstats.cultoaprint_csv_headercurpxsrv_hlt_ststats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafterfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwendacl_match_domdefault_acl_listout_free_expracl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_stracl_match_subtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructhighlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01"4sm w f  N     58;Cru~x{Sdn(Frn +pPSYx1;Oc?IMPSYPSY_4ctvORq,_oU\w#13<TdfmNi$&(2G^4vAFNct~  P  E | p !    / < &+5?pc""!! 5 U ( hJ^e^YYYU !^_!!!! !^_!!!!4###8$##{}xxM$ &]]\]x\\::/D0%//j..*+**+,,--j.D09//.%/1255441111245964523 3'3`<<<H=u@qCY[UVsCKB CVVDDEFGHdFFHIMJrJJ$KRZZ$KaKKKaKKZ["LyL`+aYO/QLMQ-RMMrsqqp8pMMAffefdeMRO5SUDQQ-RRQQ+mHmVllPjjQQU_UR5StUU[[+VQVzVV6VQVzVVWYnoHmm%lVlkkjkbb[x\+aaabb(c=cc4ggcodgh)eefffAff4ghphhii;jbii}kkl+mm9nMpqrrqq rrsnsstvvtfu(tt~vvfuuu~vvwwxy/zyy#x(x=x?x.x7xZyy/z{}ߊ-5ߊ5D-OÌGH܋8ߊ``vֆOG 2)2։Ì!$& eflE  ! ?  LNQ@lRH H`sK` '`sfyj e  5 * m  m  ze A D_ 33I%8 "  *  - @ % ' I*;qv~y~ $ +!%: W x U a M O @ L o    Q W *Nf#F / 2 , p!!!!!!!!!!!!!!!!##$H$%Z+t+++$,j,,@2-.2@211J11;00--J1]1--j..]1p1/&011)0;0//11//e00112 3*4=43344Y4t455555=55M77<<M7S7<<V7k7p8v8<<y88 9l9<<99H;;:H;=S= <u<;;<< <S<V<u<AAAASBXBcBiB\B^BB%FFFO'F*FC%F4GeGF*G'F*F.DEF*GP R iiggeed)eddbc@__7^H^#\A\Y[X+YVRVPPbc@_O_7^H^#\A\Z[`ZZYYP RQ Rbc@_O_7^H^#\A\Z[`ZZYY`RdR iiggjRRSTZZY7ZU(Vee3U7UeeAU(V*[[bc@_O_7^H^#\A\#\A\bc\\ghfg]7^ee^@_sdd__[fvf``ddbbh iggbbggccddfrghhghrgghh1] > @` 44P}_- h "6xXt  # @ D F P w +-1G`' >|Ov[@Obek``ci r c v#$o))A(h(''c''$$ )4)h({('5(<'c'Z&&$U%$$) )'',,.+.,,.+.,.0(0/0// //@0H00080%'/"[}SV=P %+ik}SVCP _ =!#/G~ :" u%Lp%u{%/G~Gv%/ p"U%t%$%|"$%%%%& '*,7'O*p'Y)+#,)O*[)g)p'v'+#,)O*'$)''''y'|'*+#,,  $,0wyn K *  *  *  ? ` 2;>@kps{ 7 = ]  q | ? D  8 j al|DQ!"63PP369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_'*xz{p  !5Y_QI=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh,7 ? WGollTo<<@c ||8l  u%p{``tt| _`tt`t<```aatc  o  4 Qerw@|^s' tk-E 9 aF0 9HQT WU $]z e 7'n  .4Hhl<|   ` t _`t````aac o !"#$%&' (/ >I/  t```c8o  `!`.p`<`HP >^/t DoHo@e Lo@5  `e +6`on;o@JP@f\DfhHfpoyss tttt `2 Pf@ Dt` '@ =`thDFHtQZc0{j t{ 0| | ~6 L - @ `h XfS )PJ 7| E{ U e  s{f Y  `gT R  ` g&;\ 5<D D`<o S<A a =Y q=Y =e P>: >s ?v @@E 0AE pBE @? A? B? .Cd =tkK` ]a l z? @_ A pC CL  )k3 C W` n Z P[A [r  \n ]A _ 0b" $`c >a Kec _`f {Pg ph  {lP 0lLl  " l. + @  {lV p h mTt T `mT m 6    `$       5 0  @$ " p + 4  = L F   O 0 \ e mk  z  0 n 0\   L Pa   (n    ! , 6  `$       5 0  @$ " pL 4  = p@ F   O  B M U ^ h 0ns P' "   $   ? U @X  N K " @ 4 - = P F ( 2 O `  0 4 8 < @s '  @J  P 2 t c    0  , D; H" P Q P L T 4 %  = & F @'( p'2 O ' L [ @nb Dnh `( x (  <)" `)" )< )k * /* 9 @:H /L. < <8! D=4 T=E HnQ EY L./ f |0| x 0 1 ,2> l3\ 3@ 4 4F @5O 5] 5\ %L62 260 C6 RxRt `T lU yV /# J#pW a#, i#p. ~#,#9 #A # #` #S #0 # $d $0S $5$c @$sN$t i$h* y$3$  $:$| $8$t $#$ $q % !%Z0% =%`F%cX%:o%%%%X%X%* %t %{ %0 %;%%h &b'&3;& I&`&=p& &ȸ& &z: &(t&@' &s&&Q &^'  'S"' n /'p =' W'@c'ou'('E ''0+ '\ '0O ' ' (C (} (pTQ,(' 4(` ;(p H(@) U(o\(  k(a(<(((:((0  (0 (pc (I (Pz )h)`D .)0oC)@AM)ud)pRj x):)4o)R )5 )s)PQ )A )s)X*o* o*`<'*g0*C*`kF Q* 8 Z*pJ s*` *o*P= **,t* * *+@ +Y + &+7 ?+N+  Y+ O g+P s+;+ +F +" +ж# +  + : +  +D, ",:2,+ :,/M,_, m,0g |, ,P,c,Fw ,$t,:, ,0"~ ,`--@8< -@t,-Pm 6-E-`` R-`3 Z-@l-Уf s-@  -L -* -09 - -=-g- -3 -f.\ .Pg -.T=.  O.b.$ w.P .. .7.L abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidshostnameoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerinit_default_instancedefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_val__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_raterecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroygetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlineeb32_inserthttp_capture_bad_messagetcp_splice_initfdcfg_cfgfiletrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserversess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0tcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_malloccfg_parse_listenwaitpid@@GLIBC_2.0acl_match_dirparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0a2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requireregcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingpcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info