ELFЗ4 4 ('$444JJhhJhJ((( Qtd/lib/ld-linux.so.2GNUafT>a+bJ(L@<'%K.6^YIX`RSW]c74F:Gd _UCV 0?Oe2#\Q9[M  ! &1 ")-/;A8=5$NEPH*D3,ZB(=H1;`YX/j=H067gM//vD7IW1po@b*:;:Z:5/%7q:;R:CXEXW:3 B5.AQ7XL@  ],3L:8#q5c:8X< ;b3!b= ^S(@ :hyXuO:iXwG;DJ:, -/i: @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strduplistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii "ii ,ii 60KdXX%X&X2XQXT@KDKHKLKPKTKXK\K `K dK hK lK pKtKxK|KKKKKKKKKKKKKKKK K!K"K#K$K'K(K)K*K+K,K-K.K/K0K1K3K4L6L8L9 L:L;L<L=L> L?$L@(LA,LC0LD4LE8LFC+-M7MX@XQQj/XRAuO8-uyX@C PF_5VFe[^_]>X7&C t{t P& ؋PktCtŃ PhXsVJ뭋]u싇P9vutUPPE썴&_0G0E9؋3u*C BCS=$69]u֋_HGHE9؋3u7C BKCQ?ZCP$69]uɋ_@G@E9؋3u GC BCCPg?XCPEXCP;$169]u 0Sd" K3QZCPD$u׋h,& C3PXCPD$u׋w\C$t/ CPF ]S@I] ]]NHtP JP ]H] P>XFP44$,ut>^HUtɋC d SE9]L]= P؃u lPC^pSCYtRwCT$ LSQM RhXu  <vPLPE 8Wh뺐USMAҍu1[%]Í'US]E Ch@^‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPvtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPP tC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PVGe[^_]ÐUVUUUWVSu M]~)<;}|o{1%@A% Š@1҈CQA% Š@C1A?@Cu [^_]Ê%N@t>1ҊA% Š@C1A@CC=C1C=@CېUSQ]{t]Ë9| C]RRjPC]Í&USP]C~ t C]PPjP⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P-C1]Ít&PPjPC뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU OEPLHP@LOO]Í'UUJLBPABPBLBPBL]ÐOUV1S=OXtC0uCLX=Oue[^]à SЃ ƋCLݍ'OUV1S=OXtC4uCLX=Oue[^]à SЃ ƋCLݍ'OUV1S=OXtC8uCLX=Oue[^]à SЃ ƋCLݍ'OUV1S=OXtC'US1ۋU t&ABHЃ v[]É'U1ɉWVSEE]߉f@f@E 9vj1C9//:%uف//:u;Kt&UF‰U9wE E}ptthte1[^_]Íe[^_]ËUEEUEEE߄uDʋU1B=wU܈EuE@E}Et_GqЉ ƒ.%uA< vu.…%I}?MAM܋EE뛃}UE)߉H øP;:tfUfBCSZ損t&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st <U jhh #%Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRhKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCP~N{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVSu]}VPM SE)ȋu)ƍ19r e[^_]RC)XP7WP= EPEPE PC;E wKC ;E vC C$;E vC$CCхu;C(r e[^_]C뮍t&v'U1ɉWVS u]U )Ћ})NjS9s SڍBX9s e[^_])PBXP>VPeEu^C;E vCC ;E vC C$;E vC$CCхu;C(r e[^_]ÉPEPEPE P[닍&'U1ɉWVS ]u} S9r e[^_]PC)XP7WPEE…%udC9wIC 9vC C$9vC$CCхu;C(r e[^_]C밍&PEPMQWsE D y&UVSEu] PMQF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EEE]WhEP. G$PG PGPGPGXPh@EP u G9EvEMQSh`UR;]}3ރtvPD;XPh&EPt2C;]|͋EEEE E,e[^_]G냋EH9tPPuVj C봍vPSh1EPHPD;XPh&EP0wEPjjh:믐USDLt0tf4EčERRPEP=x ] PEPEPEPEPXhP XS]SQMZXP]ÐUSDLttf4EčEQQPEP Uȍ] PERPEPEPXhP1ESPXP[ XQA]ÐUSQL]ttERPE PS$ ]ÍUVSuPP`OVPxtKye[^]Ít&'UVSuKxPPOVP3ue[^]Ít&'UWVSEE u]=X Ȩr4;O]EPS])PRFE8]);E+ED %8xXEE‰E<E9x(MD ÉD @D }G}1;}&D1һOfftO3G;}|1;}jEEG;}EMUEOt*f>tEOME 9D)|ƋD)U Y‰tt dd0gfffttKttU)ʉttYwDžht:hfu.t&ff(vDžhftff%pdPP$S ~)PS$unP1tA$PpP@QPЁp %PPPPnuPPnuP)R}PphPMbPVE)ʋxR|QRPElUPE OPEPdPlRhTjPǃte[^_]ÍUj4RPjDžl1USP]C  Sd]9tHS4StLHyE9Pu@Ht9RRSP]@9C}]]Í&1]PPSh]U]tNj@뽡]녍'USS]]]@B]]C,C@t ]A ]~-S,‰S,C0$C0PPCPh]؋]͍UWVS0u-Ph]ÃtC90y(e[^_]á]t@uÅuډߋS RuR1t Шt@u W9=]t:W40t)~2nG t ;W^ WM]뺋G$u WG0G0#'UWVS ]]]]ׁv]tEEPP]-Ph]4O%^F t&@u@Ett t&@uE CuP]S@H]]]C0C0C8= SÅZ@0S4҉C0t5K t;Sy SS4EхtEM)Ѕ~щMC$ EUR9S,]t@uƅEUe[^_]à SOt&U ]]j]jD]h%UVSM] 9t=@9w-t@9wotU1[^]Ðt&SA@B9rՃ[^]ÉqK9s十[9^1]‰ËQC@B9rv[^]Ðt&UWVSQMƉʉ]u F<иMbE )&ƉǍB‰U?BU{Z[^_]ÍUMU ytzt RQZYÃz% UWVS} u1ۋJ9v[^_]ó9ruF9G1ۈ9tҋVG@B19rUWVSu] SV-Z1Yx e[^_]Ë>)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh4\8]‹ 4]uȁ?BEU;%PEhP~E 9E%EU  Mb)ʉ$ҍ)Ѝ<£0e[^]É@B@UE;4; )E9FRU ؅t1PhV4U)‹E +8x:]]#48]]EU@B]B]UWVSE]]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhP脵e][^_]ÉڹQPЉ )ʋMRhQFU‹EHUE%&E.P)Rhˆh]]EEvڹPЉ)ʋMRhƈQ躴U‹EHUEf]?ډ)US]S$߯]DHx4Ћ ]Ȁxu! Jx ʀ8t ]ÍvUWVS 1=]9}-1PPEPPOu ǃF<9|Սe[^_]ÍUWV1=]19};`tF89B8~A<9|tF8t VV$uF8te1^_]e^_]U]V1S9}1`F<9}"tS8t FSS(]<9|ލe[^]Ð&UWVS EPjjhʈEEE ]19`t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99uPPEhPʭMQj jh`$EPjjh~E@EPPEPCj 蟯 ]<9cv}19} tUB4u]MPVSh0Q e1[^_]Í&UEPjjhNiRPEh$PƬ'URRuà hЃu h1ɉÐUS]t'B ]]]HC]]Ћ]á]19L~]tLJ AJ 1҅t̓ EP(x8ڋEC CEC]@]뒃 R믡]P JP 1i&US]CPeXKQ[t]P JP ]]H]Ív'UUu&]B ]@]]]H]]]x&U jjhU]]]ÐUWVS }u}t<\tFGuEe)[^_]F1ҡXDPt50MFT~~ӋM )RSPW߃듐xtFGFXF 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡXDPuHxtVVPh\1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjjϬU PUp Pe1[^]ÐUWVSP\`8`dRRj,P>`t @`PPj:dPwÅ PPj:CdPVUhPhjR' pfDžh PdWj & PPj-S衧W@jj jP&jj jSÃ@=G=v)f fFVH TAC T9cPPhj= hƍ@ hRP'Ffh uf fFV8뎍`t`8[ \PЪe[^_]PhhjPҪdfDžh<*„ Шt+DžlPPj-SJjj jSPlPdPj荦g dPөtl@l?SSdQhzO\ZPe1[^_]PdVWhPdPShQQdRhPPdPh̅뤐&UVSM ut~,tیt(1te[^]û܍v RgUt,RSRPuV]SMQhe[^]ún͍v'UWVS|E18tuLL1ɍe[^_]Ðt$u&5M1Ƀ5M=L1Ƀ=L  t' u, M M1uM1ɃM_uM1ɃM8% uM1ɃߣM.u L4u7MUB8njj jP1ɣMGu7MZUB8&jj jP觥1ɣMe1uu1Ciu1Cdu1CuR5LUB8jj jPI1ɣLSE }PWh(11gu1Ciu1Cdu1CuMLGUB8Pjj jPѤ1ɣLPE PEPh`u?Lu E@PץtN@"EP$VLt^EPE PEPh芢_3VqZYPWx^ UQE RRPEPhܒjQLU zWtL@\uuLuaUB8jj jP聣1ɣL?ڡ^ Q_ZPVȡYER@PE PEPhKUPcLUB8tvjj jPL=@=]@ } uh@PWVhP 1L@rU EQRPhējfE RPEPhP=k u4LUB8tjj jP:1ɣLt u8 LUB8pjj jP1ɣL}u0L\UB8tR P耢L1nuS=LUB8t% P>L뼋PE PEPh82] MVSQht1lu1Cou1Cgu1Cu+UB8tB8uzEE RPEPho=LUB8jj jP讠L2hPE PEPh PÅ=UB 8UB8/ fDžxPxP|PU@ Efzu fDžz=L=LxRjpPhtMnL5M" fDžxPC xjnPR9똃 Pƅ.E} u@ PWVhDM[PE PEPhxxQjpPhM؟L5LUBPE PEPh맋E RPEPhԕ] MVSQhOOtC tރ~t3 F uۃ EhPE PEPhP,EWWQV RCu UhPhh^hjEh^hjjjPV |$M] hSQh1} uhWVhU hDjh^衟O^ ^_$`9a8a____4^0^0^0^<^8^8^8^`_\_\_\_L^H^H^H^d_h_l_p_t_x_|__Ív'UWVS\EDž8t, Dž8UB8 P vPPE=]@PVul (S蹧Z}YPGP P蠧} uPWVh:] T]SSShDj-ã] MTC0 C4C0C8]C ōsUD8<]%} tVē;uӋLLU;jLBL1 5aV _[Q Z_PXD_PXT_PX=,^Wٓ^P`S̓Y_R迓_ aP蜓@~1]^(`/}PE PWh( nމw]PP;u鋽Gύ uQMQ:t&PPPR}PE PEPhgۍ uIEXB1U EQRPhЗ|1iu1Cdu1C^ZMA8.jj jPQ ] '&9t 9 Tu1JE RRjSPEPjP 1҅"UB8E!] TW3M ]qV~X@Pj }T]XQWRTP]TX1PPEj} u]PWVjS 1҅g]PH!1҉HP ui1G +1tu1Ccu1Cpu1CuX1APE PEPhZ1@ 1G}] M7VSQh(d PPE PEPh|3}UM SQRh̘  MDžDžq>6v UUUU@E:1au1Blu1Blu1Btf1ou1Bdu1Bdu1Bt gE }SPWhDž]1҉1au1Ccu1Clu1C^U JQyuc]0SSPEPZ}U EOQRPh<S}PE PEPhx3M } uQRPWVhԙ Eu ]8WVSho޿ &.X6N^EX1iu1Cfu1Ct<8PQ0PEPt|} x]P L}D8sDžCCE8u]W}0VPPƅ_E FPPj(j;ÉpXPy CP臈 Ct8 PhC Q V%C$][S PDSXD@]K{Qt EPE PEPh|K]UQQjE RPEP]jP 1҅MA8xj]j jP薇1҉$PPEj=]PE PEPjWN 1҅UZMA8] DR諈}X]GP؇ D]DP݆ Hjj jGPՆL]L?~-E j?PEPhx]ǂL?1ҋDD1] MVSQh/P}wU8=]^UB 8t4R1lu1Beu1Bnu1Bu }G8u'E PRPE PEPh茾PPjj!á]Udz XWUM Cq Vc }Cjj jOQ[ C @jPh\C]\dQ\KDD1j EMS] 0VSQh@ʽF HEUp0=]^MA 8t4Q1lu1Beu1Bnu1Bu }G8u'E PRPE PEPh'PPjj輅á]Uhz XWM Cq V }Cjj jOQ C @jPh\C]`hQ`KDU ] MzW2VSQh@mEu ]8WVShMUM SQRhԜ0MPE PEPh$PE PEPho P K C$QRP考C S$; MaDx-AgDe=0C C s} M] P7VSQhh~c9}D8Dž6UE RPEPh$j ^QQMjE RPEPjP 1҅N}G8E@‰1iu1Bfu1Bt%<8]0QSPE PƅE FpFPPjj͂UÉp_rV [ ]C ]PL ]SXLH1҉cPE PEPhʹF}u ]?WVSh$誹&PPhpV%vtPE RPEPh;E RPEPhtXUu ]:WVSh8< EX;t/1UWWQRR}uӡ@t/1@WW}QWRw}B@uӋUD D1E RPE PEPhh* }D8tmCDžMPPjAPE PEPP]P 1҅4}u~]Z ÉZ1U } uPPWVhho uh}D8t5CDž/]J!JzM E SRPEPhhl }D8c Cjj jR}-- PPE PEPhwPE PEPhZPPjGPE PEPHP]P@ 1҅}u]Dr Ɖr1]DZ!ÉZu=D DkE@PE PEPh袵c bƎ   YYQ}$]{tRjhюP|E=]DžpLJ>dUD8PPPDPbtk]‰!U;dMU EIQRPh\t}PPu ]PGP?WVShȳDUމ(UD8 P6|XE]DP_{] P^z  P{ ]}A%@A?E@ 8tuh Py_Vyt4$x]EYP R@PhVWqz jIxtVjhPy]ǀEQQjPE RPEP]jP 1҅P] Ppz]B% BJ}PPj5]PE PEPjV 1҅G8=] 0PyXE]@P(y 0]0P-x U4jj jB P"x M8jPAPܨ]x<QQhJPN E RPEPhЗ萰 PPEjPE PEP]jPy 1҅UB8] QxMZ]APx=] PwDž Ep>tW =]GGG};u]QЃ H!Ш Ѓ4H!ƒ4E RPEPhȟS} u ]?WPVSh,UM SQRhXUM SQRhnU} uPWVhҮNt}P t#UPPj=]PE PEPjW 1҅M] 1MVSQh$Ϯ]PPL}PPjPE PEP]jP- 1҅G8] P,RvXE]@PuC,PE PEPh|ŭAMPPj} Au]PWVjS 1҅] Q3v=]UG% GB8}w > POt4$EtMAZ8to P(tà Ss]XZUB8u*MPy WqVh3SStgZ뚃 Psp4$r]Wh@VQt jrrtRjhXPs]ǀ}PPju ] ]WVSjQ 1҅x](t PP(qB BaUPPM =]G_E } uPRPWVhtxމ=]G }PPju ] ]PVSjQ 1҅w]P@P1E@PE PEPhRPE PEPh57] MVSQhE P;Xw?9L}Uu M:WVQhPً ‰rU}PE PWh\虦E} uPWVhyUM USQRhYn u]1ҋGGMUM SQRh} u ]GP?WVShg޿cf >ȏMQ:,WjPRp]1] MVSQhp:OUB8GRRPPPD}PE PWhЗǤC1iu1Gfu1G<uKDžCu ]PVSh\PE PEPhܥ?} u ]P?WVShDžR C^PPEjPE PEPjP 1҅6UWWj:rV*h} ]GP肓SPS PS$@ C(vEWWh`]0] MVSQjRS 1҅UB8tBj]j jPAj1҉MUM SQRhmPE PEPhԢP}U EQRPh财0Ώ3֏:^ MPPjPE PEPjPb 1҅}G8 E HQ臑o PPhTjjÅ9 ] SDžB\Z\APC@MCDC@qCVi}YWRiPPj:Wf ƅ@jj jPh1҃fXVDPu CC W<SLPSPPST@ CXfffCN<$iEp ǃǃǃǃǃǃǃǃC<ǃDž>1iu1Bdu1B}D8jj jPkg=PR@\t9t ;P苅U?Rt0uafufftff{{Ct']pdFpdC1҉CfDž(]H`AH`PE PEPhUCufffu]t#fx t=f@f%fZPE PEPh if@fPE PEPh|ȞD}PE PEPh衞 ݏ3   F~  OuXSSEAssLLU8gPP}PPE jPEPhC U QPERPh E?KKGE h7PEPhHәO UM h7h0QRh謙(7u ]WVShp ōaUD8tbt Pa} DPa P` C|LLREPE PEPh̘=S SP衈SlPSpPSt@ Cx E }h0h7PWhcEjj jDPj_C<Ejj jDPF_C,Ejj jDP"_C0Ejj jDP^ƒ@=fE tV蟇PP@ CPjPEDPQtLPjPEDP]PP}Pu <]WjVShƖB RPE PEPh,螖PjPEDPyult0) u R]WVSh@PPUPPE jPEPh U QPERPhȪbPPUW] 4MVjSQh贕0 RPE PEPh茕Ejj jTR\)Ejj jLQl\E DP]U CtV\CE DP\U CDP[C T}PE PWhЗ赔1U RRPE PEPhl荔 ?u ]WVShpUE U QRPhP1lu1Cou1Cgu1CuWUZ;t1B8uB ;t}G8E RPEPhӓO07'NtU^t]}PPjPE PEPjP` 1҅G8tG8u@Eu ]8WVShdMU E QRPhwQQj j[ UjRRP$} GPZP]TjSPCPE PEPh肒 u ]h0h7VSh[ PʓÅhUB 8}G8/ fDžxPxP|PU@ Efzu fDžz]89xWjpPRXY]9]@ fDžxP# xjnPRY뇃 P蓒ƅMu ]y WVShD-$Y] MVSQhxXxQjpPRX]8]<GPE PEPh\=^ UQQjE RPEPjP药 1҅MA8WWj jX }jwVPljj]STP«-PPEj=]PE PEPjW 1҅tUB8] PPPPyX]MǃPǃL_qV},P0P4@ 8]wDžXX>76E|?>ul]HHLLU;s1;MAPE PEPh 螎 Eu5]PPxu ]h7VShHRξ] {{V)~<P@PD@ H ōމUD8 ]Pt PjV=]U TRU] PPPT LLLoUE U QRPh̘*馽}PPh7hc}PE PWh<z] MVVhōh7h0SQhӌOOU EQRPh 赌1PE PEPh蘌Eu ]8WVShxls^CUPPj} uPWVjS; 1҅MA8PPj jT }jGPS@jjtމu2=]G] MVSQh蟋 |މ=]wwMA8tRRPPP[xPE PEPhЗ 鉻QjPEPRulPPP]PPv.}PE PWhЗ豊-cމu8=]_ _PE PEPhXfމzE\<<. CQQj.PN SyE ]DGPQ] MVSQh踉4 PWWjPquп] MVSQhЗSϹM TRPE PEPhЮ$頹ME TRPEPhx}] 4MVSQhpՈQUPE PEPh赈1}E RPEPh 蕈 PPrؾPE PEPhЗ[׸QQMjE RPEP]jPD 1҅}G8t~j]j jP2O1҉~PPEhPE PEP]jP 1҅OUB8t?j]j jPN1҉"PE PEPh艇:u ]WVShlPPEjPE PEP]jPU 1҅E=]Werroh^Ħr nehȦar 'P̦balaЦnce'Ԧ.Au ]hVSh }jGPS9E pV=P]XjSPXUM PQRhuPPj j,> UjzWP} WRN=P]XjSPߐPE PEPhu隥G}PE PWh u|EPE PEPht\? a^1MPPj}PE PWjV裓 1҅ }G8PPj j= ËEj@PS訵M AP6<P]XjSPǏ} uPWVht邤E RPEPhhseM] qMVSQh sDUBPE PEPh s#UM SQRhhsUPE PEPhjsHu^PPEjPE PEPjP1 1҅5]P lMQ:C PR:O t$X td f}PPjPE PEP]jP莑 1҅G8Ejj jXdSv9U 2 XQQ;9MZËAP,9D$ 8}5XQËWVhpSU; Dž9< A~ۋU EQRPh r$P:飳U} uPWVh8{q1}UM SQRh\qءUM SQRh?q黡y OOoC tރ~ F uӡ] W9]1, \QQ7ËEZ@P7D$6UËBP\QPr} uPWVhWpӠPPE8WN Q56 ]RUPhh^h78]h^hh^PEjPV |'~E hPEPhNp1K1DE hPEPho% ]M} PuPWVhPo}PPjPE PEP]jPi 1҅ПG85QQjP~7ƅRPVj!6D^~) U^h^BPE PEPh@Zo S4 SPVu89  V3}jj jOQ5Dž94 @~E VPEPhnXPE M UxWXSQRh&n x V2鏞u ]WVSh4mt] R6]?M }APAPE PWh|mVd2^S'6&UWVST DžMDžhDžQ@6Y)PWhQ3 GDžV3‰Љ)=1XvF1DB u1tp\#€  Шd [1XDB F1DB uGƒ?%u;G@G@~1nu1Cou1CuFDž18tG8u식xtD t4޹t$ތ޹t  ]DžP3XP2]MVPSQ  ]Pz3]e[^_]F&N €\ Ш#r*n&t"^xt8F; FPXY FP@Yt FX F00 v< vDžR^)BHPRS0)ЃDž뵀z hPEPhȳki ]P2]   PPEPh넍t& 5]1V1[Q]0XZjjyuЋTT҉uDžD  Gj/ (t WhG_  @t .G,GHwH9YSjOQV Ru?Å 9 N Ql0^ 1҅t ‰69uw^(t dttFG\t?pt tu+ (P:]VPSh,g^t?hh_9(tll_9G\`Pjhh臃tu G\1ۅuЉW\_\uGhG|%LJ=5= WfyDD_\؅WtsK u߉ÅS0C,9S,PPj/V-@PjGPV*=HQQRP=ƅ@H;tW@A%@9 P-d_T)GPu9_TtG@t BBǂǂuv ]DžP,XW&,]RPPEP踃(}PPWh@}t7u3C0PF PPhcC9 (VU6[Q}RPWh& Q'6RPEPh>cFG Tf=tz @t.1ҋGt5L Ɖ5Luԅt.1ҋDGt5LL Ɖ5L@uԋTu ]P0+1]h_upu p_Dh9l_upu p_=lG7 LJj( jhP)\ QjPh~l`RjPhx~pTp b{uPjjs V8ƅ9 C P)1҉s t ‰PjGPw,V8Å&9D G,P)1҉_,t ‰5G\*PPEPhL{`@ W=T/ W G w Wh W ]VVSW8u %G(S2YRPEhPh)` MVSQhض QL2]VPShc_A(}PPWh]VVSW,8(u2 P1RPEPh̷^F_\m (Q1RPEPh ,_= hT'PG,PPh^zPC PPhc^@ Q1RPEPh^t&PF PPh4F (V0[QRPEPhl] ]P&]SO,QRhĹ]@QS RPh (Q=0 RVQRPEPh49]| (Q/YZV]RVPShǃ (P/ VQ]RVPSh뇃 (V/ZYVQRPEPhXRUOEPOO]ÉUEPQP@ ]ÐUMAt9}]Ë)Ћ]ÍUUJtH9ttu]ÍuދܐUSá@(QS. RPhn[X(P1.YRPhԻjS ]]ÍUWVS x@P@E9t]2 69tOZC@tC$ C$R[C$u ScC0@6C0E@9EuEe[^_]Í&'UWVS1 tn1Qt&FtVtLX P'[K$u S1cS0G@S0F,t V$9re[^_]ÍvUWVSƋ9t:F ƒރ FUFV]EXZPFEFtQunPh|h^SW  F4PF$WPFxdt H`tnRPdR@`Phh^SW(hhY}tghhj^SZFHduP`tx @F t udže[^_]hhj뗃 R@Phh^SV 끍UWVS Ƌ9t%u9|He[^_]ËNAdu y`n9}Ӌ)߉FƒAFAit!9& ]VEXZPFEFtQunPhh^SU  F4NPF$WPydt Q`tnPAdPA`PhXh^SWU(hheW~hhjWX Ft Xub9})É؋Éc VЃN R@Phh^ST V'UWVSËHu H@SEXZPECtQCunPhh^VT C4PWCxdt H`tnRPdR@`PhXh^VShhUhhjCPWC xdup`tTCt&ue[^_]à R@Phh^VCS 8&륍t&UWVSËHu߉H@SEXZPECtQCunPhh^VR C4PWCxdt H`tnRPdRx`WhXh^VzRhhThhjsVU Ctue[^_]à R@Phh^V R PvUWVSWt:G@@t1 to uu;ЋH9| LJ1SaL WL˻Q)΍6P$]|P$ оM)BSlE9WUBi)ET}U WЃU0J4)…JEɉH40uxt&/;H@E50H4)WpuuEH4tڅtʅt )؅~ډыUɉJ4u` jhwjjS @G@@t jhwj jS E؋E܋EEfffEڋG%1E=cG\VPEPSt!~\CVujVSO@vsfrj .WBt%1E=bP-,MVPQS>A G (QPW RPhhHGLE؋GPE܋GTEGXY G|@PPjjS |wlE_PPGPhdQRGPhtڡ]DC;~]MLp|DDPzD tDDQQjS0uEH4Gp0uڅtʅt )؅~ڋMQ4aӅW)ЅKuUB4ыG (PW VPh6L @PPPjjS W<Ev'UWVSEEEEzEX\tChuETEuЋ}= j $ EEX\EU‰E Ct26B @B 6]F @F$]EF0F@sHF8~^<=0t S';E S‹EЃ}~4tF t;~y VMuMEFuM"ETEe1[^_]à S=~'Et S{;E} SjEE@ERUG REbVSEQhL/De[^_]ÿUWVSQ]CE9r`s,C@tI9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjhԾ<`P%Ð&UMQPQQA ǂt)H4BJPP JP ]ÉBBJPP JP ]ÍvU1҉WVSu} F4tV@хt_tUFtOCREˆEAUU䋀9tl%tUى1t2YQK$K$V BV Xu ؍e[^_]à VЃCE렋EU@9B놉'UWVS uFVEZ9~ }7PPEPVt$XC$u SjJC0@C09~ |ɍe[^_]ÐUSRP] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 R^JUWVS}]EW$VjPjC@P @tC$ C$e[^_]QWVS@RC$ C$e[^_]UWVS\U]TM 9@9LJshDžPRQEPY@m2W J AJ  F$FF(0F5F Ffh B @B B ]A ]C C$C0C@RhhRPX9 LShjQ%@ jhwjjQ @ G'@V^rt Eud>EdEP:PEjPR$$U(uQPuRUWPShuV]SE UEEe[^_]ËMtU9tSh0UREPEt+? u^Eu||E UuhhU SPhdEPEP?e[^_]֏tT tDLt ubEupLpEgUut֏tUCShEPEPTuUu€ƀU uEuxxEuuUullUEPhK&UWVS(]EE uuE TuS}:EjjPRyƋEU(tREt=UM9t) hTh(h4]MSQ E 7Ee[^_]ÐPM$RPhTh(hd벃 hTh(h]MSQ몃 Ph(h]WsVPhTh(h&UWVS E} t&Tt;(!9uPPEPPuϋC;E uLEu]뻋Ee[^_]ËE(P4$$PEPh'e1[^_]P$] S$MQhd'XE ZP$h빍vU1WVS 1}t-_\t$t&PPM QR&tue[^_]Í&uދPPE Ph'e1[^_]ÍUVS]u u;XuaTTChe1[^]Ë(PtYRPVh'Xtv(PDYRPVhL&T|(PYRPVh&TY(PYRPVh~&Ch6% Ch(PYRPVhPB&1e[^]ÍUWVSDžt5TF uDžputz{uPxjdPS`NjEutt ttpۉpupuF PhyjVw&tte[^_]Ë(Q]x$RPhr$t t[ppe(Px$QPh$릐t&US  jj5v{ tjPP(P$h>$ZYPP(Pr$hjSR% 0tHTu]ø䐍t&UVSuFt&PPjP,u"PPuP Q*tF ue[^]ÍvRRjPuPPjP~ tF 뺍&'UVSu t&t+ SM {~ S THTF e[^]Í'UWVS @}59LO~ Ttl9rЃ~ u SuF 뾐 SuF Tt~ u͋ 5E&RRPh!PhjV)#V>TtB~ tH 0t)ȅ~9tӅt˅t)Ѕ~Ӎt&봍e[^_]Ë SuF PjSPA0tڅtʅt )؅~ډ܍'UVS1RRjjx1(C PP(P$h XP(P$hjS!S{ tKQR(P$h7 XP(Ps$hjSS! T%ue[^]à h hjj!e[^];t&'UVSPPjj:0 t&T{ uPP(V$hkYR(P$hjS 3 C tPPuPPu;@9L~9sPPjPC 렍e[^]f~ thfFfƋP(Q$VhXZP(Q$VhjSSfFf떉'UhP0ÐUMyt]ÉDQADQHQǁQǁ@Q@HQ] UWVS DžtUB@@9Љd`!t ‹;dt`M1{uҋsplh{< RVhDhP = PVhNhP = P PPPPVPjlPzPfDžx ƅjjjjDž^9L PhjWc@+PxjnPW)pƒl ШhRPPjWhPPVP P];CDG;~]DDD D\]DD1te[^_]à hle hx 8 h[8uPPPV8 hPPhPP@ hD P2<$$- htlPpQRP@덃 hy닃 hj떃 h0[j hhIYXVPF88 Vp'v h&'UWVSEP@x@9`9`C~ۃ P- CCjtjj ƅxPtjlPzPfDžxb xjnEPV<x7 V\PPjPCdt&e1[^_]8ou tQE뫐&UWVSU]=LT%`DX@9LQt&XHXX2dhDždPRQEP\@`9B @B CC$:CC CC(B @B ^]@G ]G$G0G@PhVhPQ+\9L'QhjR@$`G@_:tF;ur~;}s!1F@tG;}s 1@u]uU)ЋS9uQRESRPQuҋKEMu'S B @B UE SUMEt|MC )M9}EPEPWR踻CUM]vE U1DUDUEfDf%Ee[^_]à h룃 RwC'UWVS]u} UCM$B91@tЋ^0))؉F4N)ȉF [^_]Ðt&B91@tꀸ@Ћ^()B)ػ F,9s|1@u\)F0낐B91@uꀸ@Ћ^ )B)ػ F$9s,1@ur)F(g@tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0@tB9o 딻덐&UWVSE]UM}$B91@uꀸ@u )K0)ȉC4{)C [^_]B91@tꀸ@u )s()BC,9ʸ1@ugu )C0jB91@uꀸ@u )s )BC$9ʸs31@u[u )C(U@tjB9zu tM t1[^_]øٸҸˀ@tLB9r붍vK(u ))ȉC,} )C4C0@tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$,:؋U)CXG9sɊ1Ѐ@(C9r몊1Ѐ@tC9r돋MXMEW$PVS]RSWÅl8 EfG f% Љ_ uC9&O4tB C9_1Ѐ@H uC9 ECUX$G)ЃXGG9s WBW9r1Ѐ@uC9r}_ uC9e uKC9P1Ѐ@uWMA PQ: %PO)R MY$ MXMEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ@ uC9[ =C9B1Ѐ@OOEDX9VUDX G@GDX97UDX G@GDX9r@ ~C9; C191Ѐ@tUXU9_G @V C 9R; 6C9;1Ѐ@tUXU9uR_G Mfyt tE f@ f@f@WEЍPXWM EY$jjSPQ5EUGà rG 놋M uY$jjSVQEUGà rG C9NC91>&'UWVSLE}EE PE1UMUIDM1ɋ]9EUM@,EyR@ЉUÉE؃XE918bU؋MuD U9UEЍ&޿HC9]s]]UZ t@MEȋUM\XDN9r&Ẻ ޿LC9]s捶UEЋMU\XDT9r Eȉ޿WJC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh\ !U1D\fDf%ƅuMYUkr}&U܋U܅M܋QB9uEypу9u΋U]K0fǃ@fǃ A<0@C@@ PPQSxe[^_]ËEEt&MEWqTQVShX]EEǃZUYPB,@LPkMA,@4A$puPA$m] C$]EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF80t)Ѕ~ e1[^_]á)Ћ MbLJE))ʋM>ʉtQQjS,_ZPNLQCF4F8BC$puPC$S C$e1[^_]Ít&UWVSL}GW< DBUԋU 1ۋB]ċ$E؉MEPPwVjhs]܃ }M؋ERjhPZ] uE[]9GE01ЈU@uqv ҉URAXM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ@tMԋ]M9sNwElƉu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjhQ讪>E0'PEjhSP{uUωPEj hPLtˍ&PEj hP'ًUQjhR3듋u)MSjhQxUB<"<, Ш^Ev'UVS]u fft>fHtUǃhPPjSaZYPFPP%C$ptu C$%e[^]ÀPC$ٍvPCPPVS螡xe[^]UWVSEEM EP$ыUf@%ETTXUMEMPfDf%E܅<] f%41GD0EEUjhj SBP;! u>MAw3$ME]CBtUM܋EM&1e[^_]Ë]C9CuыEًP I,S[0tAC pA$UB 6]UEBlME[ ujjVS] SM] MMQ0‰Q0IfWf% ЉfEfH Eh@ PShIM $hVSQUƒ fUUz0ljz0]Kƒ ШvUWVS ]}u_O1tLS$E EX EƋC8ƊEEjhj PGP tUEe[^_]Ít&Gw$UB9BuҋEW H,X0PtAC pA$UB E뙋UBBӋڊEhG PEPh}M $hVWQS0{$ƒ S0U DXMSjjPE QXjPCP>ƃS f‹% ЉOƒ Шu 41UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPW|uыM PSQW&UWVS|EEM EċPdыUf@%TLXMMċQfBf%Etcu}}Uf%481Bj hVWD0E…u,EE}ċMWfDf%Eue[^_]ÐMċ}}u0 E‰U9ruu듋Uӊ<;t<=t<;t C9s<=u9tր;;tэKM9tljMs51SЋ XDA u!;t}G}9us}1DA tߋUBDt&MċuuM)΋Hu9C؋Mu);[u00ًU)ыu9ɉU ]ȋPp cz Gz t}GR8PEPQdG8CXZPG<P購ÅMȅtP JP Su, z Gz KS:M0A1ɋxt |C K@C MAD9u׉EċMt uFu}G$zE@m E} jjPEPWUċuJ}fV f% ЉfEċufH HpـuHp9u׉u B @B Eĉʅɉ}GL;E}Ƌ}PVWR[Uċ0MIM=z}QVPR: Tz Gz ˅EȋUẺAA QQSB<PBMAA B @PBPEPEPE PI}uNjU}}fMwpƋwp@ ~  R] RJ hC MhjYS hPMăH R" R J QBPEPEPE PXuË}fE؉EGp؉Gp hp EhpjXSUWVSU}ȍt2 ,Z CZ UBR8SVQPUB8GXZUPB<P虷DžMȅtP JP E1ɋ0pxt G O@G G^\tgPPGPP˗u'CF@Uċ$? 븃 h hEjXS^e[^_]à R}V h,lɋ z Gz υtZEȋUẺAA QQWB<PUċEH$H$NMȅtp Np h` h` RZUWVSEEUM Eċp$f@%TLXMMċQfBf%EtiuEE]UMf%؉E1BUjhRDQE7u(EċMuPfDf%Eue[^_]ËUMEdEEE9=Xud@dE9ds%d;€, Шu1DG uËU9d-ds ;=tC;]r;]KuM9M9s=1SЋ XDA u);t$,t}EG}9Esu1DA t׋d8$UBDMċud)΋Hu9|r9d׉ua} qB @B EąɉCUBL;E}PdWPQږMċ8u؋dv)l;,E@EEta djjPEPE PWuMuuĉMM}V0fE@}V0EE ll0Ed)d9ɉ(]ȋ )r Fr _UuBR8WVQȕMA8CXZPA<PÅMȅtP JP Cuvlv\tLPPCPPfu-F=lB@-Uċ$? 6ul0x1Ʌt C K@C uEd9zEtAE E}u jjPWVzUfEM؃ EA0؉A0u9d׉llU@\UEA tuu9sE8~t @UE9rM9Mtutxu)Ή| u6ut_EPt@ ;|u9u׉uыE@mlB@]Mċu6$?u uuċx $?@luH9u%E dUEU ]MU jjSQRuĉËENufPf% ЉEċUfH fE h,MIl z Gz ˅tEȋUẺAA QQSB<P諮 E}M @jjPWQ*UM‰uUq0UƉq0uf}UBv }EEUl MċEP$P$ R hP R R h EhjHQfEċMUB$ɉB$Mȅtp Np h`G uh`j^S\UWVSEEM UZdf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSM }]Q,BPf@ %PBLf@ %PEPAVQhhՍ]Ɖ)) 9~@RPWP藲ƃƆ FuE Ee[^_]Ո'UWVS,MUEI0R,EUMA4]A9A$]sVEPSQL]mEUX4X4J ȋMXtB߉tVVZ,SEJ(ȃXPZ]===]uMY$Y$Y]UXMMQAZ@ ة!A$]MCd[1fCETfCf%LXM܉E؅U؍]Ћ]܋Mf%41AD0Ej hVSyt6Uz${PjhuSUz$EM؉MԋXfDf%E؅hU1ۋP~.MqyXECPVWEPU9PۋMY;]Epu0uDuFtRREPEPSUrF]t*C$BF <E80U%8=8zMy$ YFS Щ!t'Ex$ @ M|_0Uz$E@(^x]M )?9r EjPEPSGP+‹G xu˅1҈…tEEG=-=/w \QP}\QEE=^!]VPRS{}  UO =ZEPQwVRI}G]É]O \UEu EUMEG}  PPVGLPcEp$pu Pp$u Ur$1e[^_]Ë}G$G${8s8u3?9tn EMjPQSW uׅ%t͋UMǂ VVjQ@Zu YPFLP2TEp$u`X;|tU@;vF 9SZCZEp$p$U MYQCJ ȩ! }u _G$1fCDžhTfCf%tXplldpdf%<1Bj hWSD8pXt6Mq$PjhuS{Ur$ulh^fDf%lP|1L~=UZ|`xM PVSQ|G9Lϋ|PtUMq$|ËxHH9ut&uD?9b EjPEP|PGP‹G xuŅ1҈…t_ UZ@;vF 9:JAJEP,p0tF BpBU$r$B r$f|x,U@z;v @9P B@BUtыr0R,F BpBq$$A q$;|$_C t 70u0uEPDtUuVCr t}fff m Mq$uBQAZ@ ة!t-}4 E O ȋW0Ѐx_0 Ur$-ME 0} G(^]7Mu t~Q,BXJ(B B$B B,B0Bt} U 0G4G4B1ҋht  ‹M ҉Q8u0A8}_#}RPE PW'Zu t&Mq$REXM Mu ]AǁF4WWjS!ZYPFLP\}GG `QP7u`QE1 pjjVS] S膪upd‹N0^pN0hfW f% ЉffN PPEWPzQ} G4 XQPtXQE jhuWS] Sܩ}dp W0f‹EW0pp$8EU SeDt-CoDokiefD : EVUEЋ_ SO$QPtUG ЋUEf EE>E>ƅPEX@HˋPD)GMW=ZDEGMRPQtGUƒUEMRSVPsE؉E@;v @9 B@BEp$p$G19@<?@9|,Y$} 7EUxJ(QR,Rj?PquM FQ< 2 )r}4uE O ȋW0Ѐx_1K 9$u ]E}uWS@EPEjhsE  } MERjhPs U B42B4E 0} 7uSE N QV ЃXPEP}_}PPE PWMQYUG8/t!;tM!;}ǨPVPh`qX1ZGP1GP1GP1Ph{PrVEhu PEPV, KPEUPB,PE z(XP蓛MYM} LJSSjQ贩oU;J, r(E TpX9M߉|\A$\ A$9Y EjPEPSVk ~u %6ËE W Ћw,XÉGG Å} E j hSSP赤U zǍDzjjPE rXVjPRÅBuM; ^A f% Љ+ B @B uɉz}_ ~UE z VSXPQ"oMutt VU 2MB4AGq$pu q$}w$tu}E W _ ЍpXESVPhE1fCTfCf։ǁ(MQf%0ESVPhWuV1DtfDfǁuGdRPEUX4SÃE SJ ȃXP腰(U 2Euj.VPj m}WWPËQhm VhPnÉ$SVQuE P80t ) } @҉7M0A1ɋ|t u N8}ϋr)ljHBBEU MxB)ЋY L^v^E \XPQSRkU MB$)Ѓ Y ؃XF B)ЋQ Ћ8XF4 UFFBFE8hPR}kA M jhSSQ8Wƒ W\M 1rT)ƉHBBUBRSWϋr)ljHUBB hP b RMu]džVVjS訣Z} YPGLPiQEUBG4Fr$pu r$Mq$vu]džVVjS(} ZYPGLPPEUBG4Gr$pu{ EjhiPEPE P輞E p$r EEPEPWjh] tf} t4MYu}]LJVVjSLZYPE xLW>MERj hP?jEX UZEU ǀPPh<BLPϋr)ljHt1BBTBjrѸ MEWSAPjh۞E uUM]UB19ڋ$|9s EU19|9M Y41Y4PE}PEPEP赖u1]M|'~ }O8_ST1 PP$u"CT90&UBAЉU%NE)@uC0t E8ZEpF$u V躜~0~0U܋}܋u]}܋U܉uUdEe[^_]Í&ЃyK0Eܩ UUCr CCTRRjQjxWjV ?C0)ȉC0KDSHCT8ω8U܀8Z9 MK0뒋CS(EEU؋Ect&CXC$C C}؅h@WCPEP[CȉCCȉECEȉEC0t9vʋs,)։C0s,E]|39CuʋC(KDSHE9EW9E}%CAC@@CA<v }܁}܋E܉E5]D0E9 ME@uNuMESC 9vJE)ЍxXU܉붐D3SU9CuCXC);}OGU܉6PPEjPCEC 1ɋ0t }K26CP8UBUBB>CTtUJJu PCTESE@5]E d03M3Q{^UBBFt\U8 }%U!‰UEtE}%tdCAC@@CA<v u܋E܃E܋EqU9UuC@CA@C@<v؋E E˸y5]gCAC@몋BBPPjVCPC$P$t/jT8 aEPPCTe]33]9L}܃}܋U܉ICTEЉUSP]S, u4 BStEw#tQC(S@ ]Ðt&St#C(@ ]ÉS݋C( t SK Q転PPjK QXZj[ SS]ÍUWVS E]]|Tw,tDtNUD]dG_GC$u SC0C0e[^_]Ít&LEFTuHF,uA% = /t __QQjURF& F,uFTt%"=W(Bt!B 0EttEEB%=uFL@t PP )_s$u SK0K0U]UUdEe[^_]á]xEwF1ۋ0tt É^5v? W> QTRDPEPoTu QPrt[stVt jW]D0F0uF,u FT?FL8E@UWVS u~(F E^, u,%PPEjPG u7K,u8STu1%=PPEjPCe[^_]u˩tċFFPPEjPsC1ҋ 0t ‰St_tW뛍vFMFPPjQ6Wu9G 1ɋ0ttAOFF*FF  R븸V&'UPPUB(:u# u%tt/PPjB PËBBQQjB PBBPPjB PƍUWVS u^,> FF ]DC,ډ> % = %=C tKC,uCTt%"=V(Bt!B =0EttsEEB)^S$u SŐC0C0e[^_]ÐCTt#F ]DF ]dFF럸놃> V끋NN C10tt lj{ vC,u {TVVPPjF P C0u{,u KT> UPP$ A @A t']B @B$]B0B@ tH0B<tJB4B8ItJ t;By Ru$@$1à Qk믍&UWVS (=t 1ҍe[^_]Pjjh轢tEt=8_\;E~Et PL9}Ƌu⋿TuË}GS}jMFQh'>RjVh(@( XPjjhgN&UWVSE#0Uu0tfE<uE<uZ{%&Ct U)Ѕ~XuS9uۋE@E}vETEyEuuF4e[^_]áLt:tt2CuPPh hPM PhjHCS PSUSRu0<E40U_UE PEPQH%Ív'US] tP JP KtH IH P JP []ÍvUSPv <PhTu C t Sv9]tlC$t- CPX]S@H]]] tX KX ] I ]]]눐UWVSUBxHtExtUB`J\Ft&ǁ uE9}}^MMEEtt&A#9tJ uUME䋚)AM9}UB\뮋M[^_]Ãt=1҉ËE;] ШtM ]vMrUP\@d@`@p@lǀtDBt2 u.t*t.Adu Au@AdApu]ËA`@A`Alt&U‹H`t @lJxBt]ËtBxBt]ËBpBtBdBx] UVS]Ss;StMu3SS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉSS빉UWVS}G\LJ0NLJMLJE0%t6Uډ]}Uu6%uʋu_|EEt01ҋFFt[E6ȉEuЋE9E|QSSjMQGLJ2}e[^_]e[^_]ËE6ȉE룉EUWVS ]SK{9 P()P(CwdNGpwd9tBtt ut቗l kufSSe[^_]Ë;䍇GGlG`HG` P螝ǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPSZe[^_])QQPWjUWVS u^\dž@TdžOdžpUdž$&CCu߉xFlFp^\dždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPW荜t&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFpFd@FFduP؅tt>9ut6.&;aiFlF`@F`O(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AlAp;B= P UZ(B$؋Z )1dEGGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P VE싗Y[X)ЉVSvUVSuue[^]Í& SqXZV )1SP觗e[^]Í'UVS]SKs9tKu4t uu=SSe[^] uu;u܃tBVp)‹FdHVpFd9u8tBtt utቖVl)‹F`HVlF` P[ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFpЉFpFd@FFduT؅ttB9ut:2;v~FlЉFlF`@F`S )1PPPQ觕Cu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xpωxpS )1QQURPNECCe[^_]Ë9]e[^_]a]e[^_]aE)plΉplY Pqsv'UVSu^\dž`YdžpXdžZdžXdž Xdž$&CCu߉^\dždždždžt\CtG uCt?tHS )1PPPP诒ue[^]Í붍&U1WVSEUu RtPEPj?V6Ã1MC؉])u)ƋEu E3vWuVj&S5ÅCM؋U)ȉ])‹EU9EU<=uM9މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1qte[^_]Íe1[^_]Q_ v'U1ɉWVS;uuȉ]9_t%!9uNjEȅt M̉E V 9F$s믋]tQ9}t5U^)ȉPPPSME苀Eu?9}tEU苒Uu4WXUSP]K$uSfBhtzBLBPBTBXBtBC@uf$fff&fff1K$]ËB t1BB B$B(1K$ƍvRt0yc$(,0뵁 zmfff&ffE Sh"K$댃 SW"K$UVSuuiF$tj1tW9tOF%t KC,C4S<~ 9S4} V e[^]à VÅtF;l%=t_F$F$F$A$Bt~bterRRSVB1b?ɀlPPPڃ S9C r䋞 FA B^'UWVS }G$u WpXG,XPPjjj*ƃC /9LM )QhjVs(@ jhwjjVE' @WBB@B%1E=]G= EPB\PSV3Å V$K PPGVhd_[QGRhjPa `e[^_]ÍvWGJ@!ȩPPVG,@LX SIWBtW%1E=S==@PEP,PSV2ÅPjSV(@G, ]@PD D ]O0L9O,DP@DL \DF;~PPjVO,APt4_$@_$P$BP$;P(PWt QЃO,WpYP1ҋ 0t ‰S1ҍe[^_]ÉP(=Et&RRhTXP^4$"pe[^_]Í& jhwj jVD$ t& jhwj jV$$ W#sorfj] btdnq V&"@wL @PPPjjV# W=Ey nPShXP]4$!^XSQGRhjP]^`BlE: Vb!K SSGQhZ\GRhjP^ yB| @PPjjV" <E hD[4$ P V 0VVhXS\C!tet~it  5VGShؿPPGPhP[GVh QGRhQ PGWhp4PPGVhZ[QGRh'UWVS ]3wC$tfSBt`C$ SuC,@Pp0u@0@4CAe[^_]ËSC,@PH01@G1҅tC,@PP0 @0@p4t?8 @,8,9B@Bt GCA9V4u$FF,t V-9F$ PR)Cs,1ɋ0l~Ptt[FPO@0p4z})ljHt"B,B랋EBݍUMAtt9}]Ë)Ћ]Ðt&UWVS EEt uuUBh% Bh1e[^_]ø ut)0uu*UBh% Bh빋UBh% Bh1؃u3UMBhq% Bh>hXUD8jj jPrEjj jDPTU(M: 1lu1Beu1Bnu1BtMD8~jj jPgUjj jDPM@,gM1Ar1Ai1A u&UB8M Ah% AhSEYPRUM APUM A8 UB 8u7U$uǂ$0Mǁ$| PEJM$벋MDPhTEPE PuEEDPhVhԋE8dd1gu1Biu1Bdu 1Bt&ddVdp LQ@Npd:tjd1uu1Biu1Bdu1B jj jpDPpNd:uv hM0L@Le1[^_] cjj jp@Pd…)L=N)NУL뎍vjj jpDP"jjjp|WNp tVB@PtjPpAPEu\ttoNVhUREPe[^_]QhRh؋pLQh\VhPh볋p\Sh$Ph\Ph둍&'U E hPEP8KÍUWVS,EEMEU@0Ew $ 1ۍe[^_]ËU{ ]fǃe[^_]Å}Ztvu PPE,CE̋U1.u1Bu Mu 9qt-tE9CűU Ku܉M̋9ωƋMulEttu 9 Efǀ Ul Ufǂu (  U B Yt ^HtcRM ΋P PP PPPWSQQPj PRPPEhh^PI@UWWR1ۋuViE]t&u E~\fǀE] fǀ(Efǀ]U4t&]tt,9Pt$]uljx}uƅuVEH9%Eԋ]ԃ ]t UԃUԋEԅu?XU] (tuJSSE ËHdQP`RHtx|ʋ׉ƍTPľPjU )P[ZYPM PPPW VSˋ QRPPPPPh$PPE苻WSQhh^PFV\dhwPMU Phh^QUF ]VVS]SB1ۃFut?hjhUG,P*6Ehjh@GSSj)PTMPhh^Qa@2QMhh^QE@XEZP1ۋEP<9P)ʍuPhh^VE$)ʍuPhh^V?s\VL]Phh^S?/M ]苹Whh^S[?Y^S1ۋUR;REP E Ps`Pj] P P1=NWs\Pu )PPFdP~`WNt^|ʋӉÍTPľPu PPPP PP WVSQM苀PPPPPPWhh^Q>V\VL jV$YRn E P _PjU PNPB Yt ^HtcRM ˋP PW VQRPPPPPPEhLh^P3=PQQS9 B&UWVSEu} E$ .t&{ t (TfdžÉufdžfdž%e[^_]øuPEhh^P4FV 9t  tHL[^]@D끍&'UWVS ] uC,K(C@A  ui tW)Ћ MbC0C4<))ʍe[^_]É%=t F@t SS{0 C4{0tQQSVЃ뫃 K Q-S01uC4CC01i UWVS u} t F$@F HF uPFFG_0uG00Ge1[^_]ÅFt B 땃࿉F$C$HC$F HF rG0t @FAۉtS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@%S4C,t S9C$s SN$N$G0_4C6C,t SV9C$ Q{tCtVGNUWVS } uG,_(EF@unC(^{]FDt uM tZVFJ@!ȩtEPjUw VBLH QU*S4C(XS4{Wv,dž E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$)Ћ Mb<))ʍe[^_]Ðt&C,@u M7 CSS$SC0 C0 3] ue[^_]CL)Ћ MbC<))ʍ|F ASS$SC,{0uC0 C V'uzf8@,8,]9,A@A0F@CCF$=p{{] ue[^_]jC,@u u F@)ȋ  )ѺMbC<)ʍSS$SC0GrC0C0@{4tB8 @,8,M9 B@Bt @FAtAW4ut0Gt*G,t Wy9G$s W SS$SC,)Ћ Mb<))ʍuY)ƉHtHAEA,JMM)Ht!BMB,Y뺋EBލv'UMQ$u#AluABQ$Q$]ÃtwQ$Q$ރt Q$΁Q$ UWVSEp<@0 ^,N0$E FDMD F| VlF N0| ^,CL8 CP8O ;E uU1UEptACL8v̀C4  %1ljptE ! C4u u CL8 uC0t M gЉU% = $ E%=%`=@%` = `@SP:u"t%=%VlBwf^lt&JFlQQPVVl~u.tϋ@tF%tPPFlPVVVlt^,E1ЩptECL8CP8EN0t&E7 uE1؉EEptAALڃ8v΀y4z 0%1ÉptE A4u. u&AL8vA9A,sA, uA0= u;A0t4M t+]9L~VFz@ E% = %`=@%` = `@1E1ЩptE^,CL8CP8U9EsL$AP8 @F@t F$AP8^,CP8x N0F4F8FlFpFDFDF|F|f uCAS{}tUt )~}Qytхt )~EʅtUt )ȅ~ʋMQ4{4t[8҉t хuEʉH4NHt˅t Љ)ȅ~ˋMډY4t˅t Љ)ȅ~ˋEX4Ee[^_]èC4C4C4C4C4,]9LVFz@ unb UC9C, "C0=K,C)9s)S0C,: -Y,A)9s)Q0A,C ' Vt`Vlf SS$SC,C0uC0@Fl $QQSVЃVl)Ћ MbFlEG))ʋMʺ VDN0rCP8F@ N0 E@C,e)؅x^lPPSV~l^, P[}^,t PG}TV[N09PPSVgt^,aPPSV! ^,PPSVPt^,7PPSV tЋ^,)E@ APPPN0Y4 @V$pU0V$VXN00*PPQVQ<N0 ALPPN0F$pA4N$@N$V`XN0^,V@qWWSV^,VlB ^lS$$fFAt B^,C4F0@4F$pu@F$h F$[t ALPPN0Af APPPTV$p V$VJX^,C44@* CPPP^,Ѐ@ CLPP^,F$p7C4N$ N$VX^,!V$0V$F F$@t ࿉F$Z$KZ$QQjV:FtAS4ut0Ct*{,t S9C$s Q^,& = /F4 ^4SVL$VP$>^,C4F0x4vF$pu F$] F$PF$ F$t CLPP^,C> CPPP,t~l ~4 ZN0^,CPHFIF$tFJ@H@Lt)Ћ Mb))ʍډVt[t+F$ u%F@tF,PH@D t V VEP t! P#U9]u ]MA$t4 ȃPQ#M=]O]Q@=]]utMX KX ]1I ] F4P߯Fl$ԯ^,¯uC 0t )ȅ}/uC 0t )ȅkuC8 0t )ȅVN0¯uA=0t )B/uA=0t )A8=0)st&t(it)V$V$F$F$6t@<oF$@F$0^tWWCPf@ %PF,@Lf@ %PFSQh[hPhjS)y~8PPfFx%PfF@%PFPWhvhPhjN~p:PPfFx%PfF@%PFPPhh8PhjxPPSV_F$0US E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ ,]ÍUU E ,1]UU E ,1]USUE у, %t []Ít&'USU E, t []U,E0]ÍUWVS묍t&UEU E/]v'UEU E.]jv'UWVSE xtUƉE H P9}2tUƉE HP9|9w[^_]É9v1[^_]ÍvU1UM :t]ËRA]3Q !ЃÍ&UWVS]} QqZƋPF1҉Gtw$e[^_]ÍvU]c4&UVSu QQj j赻Ã1t-F(R PEPS;4u^F e[^]à S}e1[^]ÍUWVSPPuE1 XEE@E1UDAeu1Cqu1Cvt1Ѓgu1Ctu 1Ct&u U뜐1Ѓgu 1CetnuEv1Ѓltu!U[1Ctu1Ct1Ѓlu1Ceu1C-E1C11EC-ƒ: Шt=&Eu/E Epx 11vC-ƒ: Шuʃ0 w1׊ËEtE~1~HEu U rz E Upxw!$|U BR U BBE@[^[^_]ÃE pxU BBՋE HE@1ȍU1WVSEu X>E]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$E @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP$%Ðt&UWEPWW]ÉUEPQP@ ]ÍUWVS u }PPWCP艱t9ue1[^_]Íe[^_]UWVSj(EPtu=WWtSu)E_t:QUsREPCPsu CU<tCu΋?Wue1[^_]Íe[^_]à EP }r&USRË@tS u CPw Sk]à P҃C PQ؍t&UWVS ǍX@09uG __uGHIHe[^_]à PGHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjj荳EtU؉PJEAJMA AAAWWj(S-tV@EQQj)PRRNjE)ǍGPjÅPWEPSE܃xX 1:-u B…t2p@ CZ E ZtM ABQ e[^_]à V  S1ҍe[^_]UWVS ExEEE9tFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjj衢]t) EEj Sh ,jP耟 1@tЋ]l]81҈ƒUUM Ѓ @]ÍUU E @1]UU E @1]USUE у@ %t []Ít&'USU E@ t []U@ED]ÍUWVS,EEE9E@ D=<UM܉}؉EԋUEM܋UEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Em=]1ۅu4u ft)0E f1)Ѕ~M )CM =<PESPWMY^PES1U;u%t-<|u FU;u%uӍe[^_]ËEH @E؃t؋]|tu^؉ڃ Dtڋ ]| v<Dd FST T S떐t&UVSLuP j<t\PPSj@t5PPSj͝Dt e[^]à @P赝 <P褝1F8Ѝe[^]Í&USD]PsX @QfZ<PZC8]U]ÍU ] |)A ]`ǀ`B4B8B,`B$pB( B @B0B`B BBBB]ÐUSQ̀Ãv nۉZ[]É'UTMʃɋU B]!Í&'UWVSEPE9EH5TUuLU1ۋuǃuɋ9tRW=d`tɃ\`̀Ãvwۉ5Pu]EC]9E`P[^_]Ít&'UV5HSӋu%PL@P ؉[^]ÐUWVSSE] ƉEC<T1uET ى Z[^_]Ít&'UWVSPE] ƉEC<T1t!E'Tt: wUU- P趃EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ蘅9sUډ@C9r18}t MQdF w$ p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1 Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1Ҹ L$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿ L$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$"~1ۊY!#E9t]υt=p/1A1ҊQ 9At1t1p/%뎉[^_]ÍvUWVS1]1O~PP$ $E PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1p/%`FW1C1ҊS ƃ>FC4M!1̓w3$P%1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊ/p/L$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ /p/T$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$p%S!1C!̓w$p&1BR Ѕ~1(jjj1p/PÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸DNju =Dt3%9uVPEP.| uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$&EU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0RT}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$(1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCSkT`MMT~`U(RjjTQtWTVPyk`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`QXl` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Qk` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP}iE`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$(EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B %z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx} @%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSPe u @CRQ V6gD;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW;f t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM11 1ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$d)E%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uE5MEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $T*jE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$+H@vP@t<)u担87DžRt# H@%u㋅8) PB<v?t { 5 B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WXЉƃ؅uDžM ERCP~NF fF(ffVffNfF}5tSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VXЋU+M MW}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$-]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB PCC MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh XU ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PXЉEupEEMP EPRQ BUM$ ABLErLPjURMQEPURCPV u'EMA`Up9RX]Ex`UH EPRQ|A1C1ҊS à ;AoEUB`Up9&RXM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ=[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE --Dž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu Dž5E8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPXЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Usage : %s -f [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon ; implies -q -q quiet mode : don't display messages -c check mode : only check config file and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %d tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Configuration file is valid : %s Error reading configuration file : %s No polling mechanism available. [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselect%d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF=I#UaInvalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%d/%s%d %s%lld %c%c %d/%d/%d/%d/%s%u %d/%d task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789:ˋ؋   #-7?@H@P[d nsplice-requestsplice-responsesplice-autoabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerpersistredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledenabledhealthbind-processevenappsessioncaptureretriesblockunlessredirectlocationheadercaphdrprefixuse_backend(unknown)optionhttplogclear-cookiecodetcploghttpchkssl-hello-chksmtpchkforwardforX-Forwarded-ForexceptEHLOHELO%s %s HELO localhost rewritedefault_backendredispHTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 drop-queryrealmhttp-checkmonitorfailindirectinsertdisable-on-404backlogfullconngracebalanceserverredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttracksourceusesrcclientclientipcliexpreqrepreqdelintefacereqdenynocachepostonlyscopedomainenablehide-versionreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionhdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionParsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : '%s': error detected while parsing condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d]: custom id has to be > 1000parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : '%s' expects 'code', 'prefix' or 'location' (was '%s'). Maybe you want 'maxconn' instead ?parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects [:], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : weight of server %s is not within 1 and 256 (%d). parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots or does not start with a dot. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). Maybe you want 'fullconn' instead ?parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. parsing %s : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. parsing [%s:%d]: negation currently supported only for options. Proxy '%s': loop detected for use_backend: '%s'. parsing %s, %s '%s' : fullconn is mandatory when minconn is set on a server. parsing %s : %s '%s' cannot use both transparent and balance mode. parsing %s : HTTP proxy %s has a cookie but no server list ! parsing %s : '%s' will be ignored for %s '%s' (requires 'option httpchk'). parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing %s : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. parsing %s : no line. Nothing to do ! parsing %s : %s '%s' cannot be in health mode as it has no frontend capability. parsing %s : servers will be ignored for %s '%s'. Errors found in configuration file, aborting. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. parsing %s : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': unable to find required use_backend: '%s'. parsing %s, %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': unable to find required setbe: '%s'. parsing %s, %s '%s', server '%s': unable to use %s/%s fortracing: disable-on-404 option inconsistency. parsing %s, %s '%s', server '%s': unable to find required proxy '%s' for tracking. parsing %s, %s '%s', server '%s': unable to use %s/%s for tracing as it does not have checks enabled. parsing %s, %s '%s', server '%s': unable to find required server '%s' for tracking. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled againCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPHTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownhttp-requestconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)timeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! parsing %s : cookie will be ignored for %s '%s' (needs 'mode http'). parsing %s : server regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : client regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : monitor-uri will be ignored for %s '%s' (needs 'mode http'). parsing %s : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. %s.%d.tmp%s.%d.bakshowstaterrorsname too long for UNIX socket. Aborting. Invalid name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket. Aborting. error when trying to preserve previous UNIX socket. Aborting. cannot change UNIX socket ownership. Aborting. socket(): not enough free sockets for UNIX listener. Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener. Aborting. cannot listen to socket for UNIX listener. Aborting. cannot switch final and temporary sockets for UNIX listener. Aborting. cannot bind socket for UNIX listener. Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE`HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. 9iCC>VBqqqqqkV7e#Yw5hW3HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%d/%d/%d/%s%d %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %d/%d%s HTTP capture : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession:calloc(). Not enough memory process_cli():asession_temp->sessid:calloc(). Not enough Memory process_cli():asession_temp->sessid:calloc(). Found Application Session without matching server. Not enough memory process_cli():asession:calloc(). Not enough memory process_cli():asession->sessid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valpathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/; domain=%sCache-control: privatesrvrepsrvhdrConnection: close: %d.%d.%d.%d HTTP/1.0 clireqclihdr: %s /Expect100-continueContent-Lengthappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_postCannot bind to tproxy source address before connect() for server %s/%s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. Cannot bind to source address before connect() for server %s/%s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance url_param' requires an URL parameter name.'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri' and 'url_param' options.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓NOLBno checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,OPENFULLSTOP activeY- %d,%d,%d,%d,%s,%d,%d,%d,%s/%s,%u,,,,,%s

%d %% text/plaintext/htmlunlimited MB Refresh: %d never exp=%s %p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate, Frontend%d%d%d%d%d%lld%lld%d%d%d%sBackend%d%d%d%d%d%d%d%d%lld%lld%d%d%d%d %u%u%s %s%d%d%d %d%s%s%d%d%s%d%d%s%d%d%d%lld%lld%d%d%d %u%u%d%s%svia %s/%s%s,%s,%d,%d,%d,%d,%s,%d,%lld,%lld,,%d,,%d,%d,%u,%u,%d%d%sDOWN%s,BACKEND,%d,%d,%d,%d,%d,%d,%lld,%lld,%d,%d,,%d,%d,%u,%u,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%d,,%d,%u, %s,FRONTEND,,,%d,%d,%d,%d,%lld,%lld,%d,%d,%d,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy version 1.3.16, released 2009/03/22

HAProxy%s

Statistics Report for pid %d


> General process information

%s
QueueSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitRateTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits : memmax = %s%s ; ulimit-n = %d
maxsock = %d ; maxconn = %d ; maxpipes = %d
current conns = %d ; current pipes = %d/%d
Running tasks : %d/%d

 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".
Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.16 Release_date: 2009/03/22 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d si=(%d,%d) as=%d ts=%02x age=%s WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: ZjǏݏJSreq_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentreject (unexpected character '%c')response-onlylayer 7cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparent'%s %s' expects a positive delay in milliseconds, in %s '%s'acl '%s' involves some %s criteria which will be ignored.ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sectionserror detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endnn:nC/nCn<n< n<n<n%<*n/<4n:GnR_na[onq~1nL 1nnnccccccc!=====c)CR"-yDumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%lu bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splice@ORUX      {m_@$match failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6daahZhZhaaaS:;<=>?@[\]^_` >82,& xdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error Oc{;;RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR?RRRRRRRR?RR?5555555<22CCYY444444444444444444444444444444444444444+4n#~#444444444444444444#444444444444444444444444444|34d4444444444444444444444444444?#4*    e H \,x0\+x0x0x0x0+x0x0x0x0x0x0x0//////////+x0k,M,,x0x0x0x0,x0x0x0x0x0x0x0x0x0x0x0x0n-x0/-:-:@:@:@:-:-:@:@:@:@:*:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@:@::@:@:@:@:::@:@:@:@::>HHH2B7G!>!>HH>HHHHHHHHHHHHHHHH!>HHHHHHHHHHHHHHHHHHHHHHHHHHH"?<H>HHHHHHHHHHHHHHHHHHHHHHHHHHHH,>?B?EqB?E?E?E?EyD?E?E?E?E?E?E?EBBBBBBBBBBB?E:DBB?E?E?E?E@C?E?E?E?E?E?E?E?E?E?E?E?E|C?EBE,F,F,FE,F,F,F,F,F,F,F,F,F,F,F,FE,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,FE,F,FE,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F,F|E,F,F,FE,F,F,F,F,FE,F,F,F,FE^PY*YYYrZZZZ['[)Z^ZjnjnjnYYPX@Y6`W`c`````````ddddddXdXd6dgggggggggjnjnjnjnjnjnjnjn^^jnP[R&RVVVVPQPQQpTO!X;VV!XNhh2iriiinhhjjjjkkj)kk?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x 5p{PPp $  wH̊l @ 4KP8o؎oo hJN^n~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^n~Εޕ.>N^n~Ζޖ.>N^n~`J N'OO†ƆʆІֆۆ߆$).48<ІBHOV]dkry@OOݾ@ @:ОPP@@@ 0000(0unix_streamnl9P@ `@Q@Q`<.p..C0//K0//T@00[0_0g0o0w0000P@`12222222@3@42222222@3@5P5P5P5P5 P5P5P5t4 pO@xU@y_@Pzl@z@}ľ #/9=IOL @ЬT ` tcpv6  9P@  VVtcpv49P@  @W@WPpP0pPpWWWW   `   @@%jU?!`&`Q g@`%Qed d P<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&W-ic9-$-c$C` DD$ c$Jl cIDK$"c$R cQDS$"d$p doDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$ DDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$\ DDD!D(D7$;d$ DD $d$ dd DD DDDD+D/d@d@d@/$/e$ dd #eDDDDDDD*D1d@d@.e@d@1$19e dlibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)3P#7p7sFK {KƆ.a @f`v0"0%q@ryx`R9rk@ol>5*1G\K/ {:@}"$Sp q5 hipl~'^Y0Pw ) 33)display_version)display_build_opts)usage)sig_soft_stop)sig_pause"*sig_listenJ*sig_dump_state*dump*init,deinit/run_poll_loop0main>2globalP2prognameb2pidt2relative_pid2trash2zero2one2nolinger2stoppingg3cfg_cfgfile3UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)#7%a2base64base64tab87 enable_listener8 disable_listener] enable_all_listeners disable_all_listeners unbind_listener unbind_all_listeners( delete_listener^ protocol_register protocol_unregister protocol_bind_all protocol_unbind_all)protocol_enable_all_protocol_disable_allFstats_check_init_uri_auth&stats_set_uristats_set_realmstats_set_refresh>stats_set_flagstats_add_authHstats_add_scope'K/#ultoa_r $strlcpy2p$limit_r$str2sun%ishexF%invalid_charo%invalid_domainchar%str2sa'str2net(str2uicH)url2sa+encode_string+str2ui+strl2ui,strl2uic:-strl2ic-strl2irc-strl2llrc[.parse_time_err/itoa_str/hextab{ `init_buffervbuffer_write2buffer_write_chunkbuffer_replace buffer_replace2r buffer_insert_line2 chunk_printf, buffer_dump pool2_bufferƆ+g%Alert%WarningP&qfprintf&get_log_level&get_log_facilityA'send_logd)tcp_sess_log+log_facilities(+log_levelsJ+monthnamel+sess_term_cond+sess_fin_statea*#__task_queue#__task_wakeup#wake_expired_tasks}&process_runnable_tasks (init_taskS)nb_taskse)run_queuew)run_queue_cur)nb_tasks_cur)niced_tasks)pool2_task)last_timerNfu_tv_ms_cmp_tv_ms_add>_tv_ms_cmp2_tv_ms_le20_tv_ms_remain _tv_ms_remain2 _tv_ms_elapsed _tv_addp _tv_add_ifset _tv_remain _tv_remain2 _tv_isle _tv_isgtk tv_update_datehuman_time]curr_sec_msocurr_sec_ms_scalednow_msnowdatestart_date0 fd_deletedisable_pollerinit_pollersIdeinit_pollersulist_pollersfork_poller cur_poller( nbpollersJ pollers\ fdtabt maxfd totalconn actconnr)  get_pipe[ kill_pipe~ put_pipe pool2_pipe pipes_live pipes_used pipes_freeR"%O#exp_replace,$check_replace_stringb$chain_regex'%pmatch%dc(-warnifnotcap-cfg_parse_global4cfg_parse_listen[readcfgfile`cfg_register_keywords`cfg_unregister_keywordsacfg_maxpconnacfg_maxconnaacl_seenbsslv3_client_hello_pkt0# #srv_downtime0#srv_getinter/81%+process_chk.start_checks_& #srv_dynamic_maxconn]#init_pendconns#pendconn_free#pendconn_get_next_sess$process_srv_queueU%pendconn_add&pool2_pendconn0x5)get_frt_addrp*event_accept 9x1&proxy_cap_str&proxy_mode_str*findproxy+findserver&,proxy_cfg_ensure_no_http,start_proxies-soft_stop-pause_proxy(.stop_proxyY.maintain_proxies/pause_proxies/listen_proxies0proxy 1next_pxidF1listenersk`6%uxst_add_listener(uxst_event_accept}+unix_sock_parse_requestY.uxst_req_analyser_stats/uxst_process_sessionob,init_proto_http[-http_header_add_tail-http_header_add_tail2F.http_header_match2.find_hdr_value_end.http_find_header20http_find_headerR1error_message82perform_http_redirectB3http_return_srv_error3http_sess_log5capture_headers6http_parse_stsline7http_parse_reqline8http_msg_analyzer:stats_check_uri_authi<http_process_tarpit=http_process_request_body>check_response_for_cacheability~?produce_content?apply_filter_to_req_headers@apply_filter_to_req_lineAapply_filters_to_request&Bmanage_server_side_cookiesDget_srv_from_appsession7Emanage_client_side_cookiesGapply_filter_to_resp_headersHapply_filter_to_sts_lineIapply_filters_to_responseJdebug_hdrJprocess_responseMhttp_process_request_pool2_capture_pool2_requri `http_is_ctl$`http_is_sep<`http_is_lwsT`http_is_sphtl`http_is_crlf`http_is_token`http_is_ver_token aHTTP_200"ahttp_200_chunk4aHTTP_301FaHTTP_302XaHTTP_303jaHTTP_401_fmtahttp_err_codesahttp_err_chunksahdr_encode_mapaurl_encode_map bhttp_methodsbsess_cookiebsess_set_cookie>-0&splice'stream_sock_shutrD'stream_sock_read)stream_sock_shutw)stream_sock_write+stream_sock_data_finish+stream_sock_chk_rcv+stream_sock_chk_snd1*$appsession_task_init%appsession_init[&appsession_refreshW'match_str'destroy'appsession_cleanup)pool2_appsess)apools)have_appsession7\lI@*recalc_server_map,init_server_map.fwrr_init_server_groups 5fwlc_init_server_treez5get_server_ph5get_server_ph_post!7assign_server>assign_server_addressL?assign_server_and_queue?connect_serverAsrv_redispatch_connectMBbe_downtimewBbackend_parse_balancew /& #stream_int_check_timeoutsu#stream_int_report_error#stream_int_return$stream_int_retnclose:4?+print_csv_header}+stats_dump_proxy,stats_dump_http-stats_dump_rawj.stats_dump_raw_to_buffer.stats_dump_sess_to_buffer20stats_dump_errors_to_bufferS5*tcpv4_bind_socketD,tcp_bind_listener:-tcpv4_add_listenera-tcpv6_add_listener-tcp_inspect_request%q553*%sess_change_server_%session_frees&init_session&session_process_counters&sess_update_st_con_tcpr'sess_update_st_cer(sess_establish(sess_update_stream_int*sess_set_term_flags*process_session1default_srv_error2pool2_session2sessionshAhdr_idx_add`~P;)acl_parse_nothing)acl_fetch_nothing?*acl_match_nothingw*acl_match_str*acl_match_reg+acl_match_beg^+acl_match_end+acl_match_sub,acl_match_dir-acl_match_domQ-acl_match_int-acl_match_ip-acl_parse_strR.acl_parse_reg.acl_parse_int0acl_parse_dotted_ver2acl_parse_ip2acl_register_keywords3acl_unregister_keywords@3find_acl_by_name3find_acl_kw4parse_acl_expr5prune_acl5parse_aclp6find_acl_default(7prune_acl_cond7parse_acl_cond8acl_exec_cond9cond_find_require:filt_cap%;default_acl_listrA% #create_pool#pool_gc2#pool_refill_alloc#pool_flush2=$pool_destroy2w$dump_poolsI'read_freq_ctrAfreq_ctr_remainnext_event_delay.feb_deleteeb_insert_dupcY[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)check_cttproxy_version3Dyh J0?>x  "0 #[:5 &t@\ 5intm 60 >E ?E AE3 C| Di  GP?G6 S^ U  0 "-< "-K<##-# ## # # #  ##y##M##7 ##z## ##$g##(##, ##0#$#4.##8##<##@#">#D` ##{#F#$*#G`#(:#H#1#L #7/#T3#8/#XS#:#\#<@#` / b#) # M## #$# ##< :  P 3BGQ8F* D E# VF# $ >+  # #  + !# # +# ; wg67#8#2>o40Yg r  n# ڰ# }#  ܓ# # 7  !kC!t !v# D !x#h n h#p h#C  - C#ref !h#04w l x# yC# z0# M {0# %|0# p}0# 0 ~0# L<0# -0#$ u0#( @ c bc# ss @ MH#s#s# bit#u32"0A* F+y#key,#dx D 0wq 1#rq 2# 6 3#0  4#4  5z#8 V 6/#<  7#@tttd  L# (# # [# C#N L# (# '8&H 6 &I0# &J0# J&K/#fd&L# L<&M0#exp&N0# 2&O# 2&P# 1&Q# 2&R#$ib&S< #(ob&S< #, &T0#0 &U/#4 < &S L<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 #8 &% #< 7#@ 7#A b#D H#L & #P 1 #T 7 #Xk P-tstru#lenv#| | <  %  z 'C# L'C# x 't# '#fe' #be' # '# L<'#$  '0#(req'< #,rep'< #0si'!#4 i '# \"'# k'#srv'# '# '# '!!#txn' # 2 '# f'L# '3!# E/'J!# '‚# 'Â# ' # @'0#k + H ]q )n !  # !q # k auid^f#gid_P# T`[# buxa  LfdM# 6 N# O# ;P# Q# SR# #"S# T0# NU# VC# >'W# Xz# ^$Y# Z/#  [0# nb # 'c# TQ um# 2n# o# p# h q# r# s#$ 1t#( 2u#, Kv#0 w#4 x#8 wy#< 7zC#@ 4{#H |C#L    *%Cf%A#b%B< # %?cb%C# J%D/# 6 %E7#ev%F7# W %G # %H#   x1<%] %^/# !=%_#set%`#clr%a# =%b# =%c#rem%d#clo%e# 1%f# 5%g#$ 8>%h#( "%i#, C%j#0 u%k#4 &%l#8 x" a ^/# _%# :`%#ar+ N,r# +-x# Y.# s/# -~ " 1 h# '#*8len*90#cr*:0#N*;0#T *Cv*DT# 0 *E# *F# P'*G# 0*H# )YY  o.L   )Z)l)ݔ#m_l)ޔ#u)ߔ#u_l)ߔ# v)#v_l)#X)l)#v_l)#c)#c_l)# r)#r_l)#u)rq)st) @) )0#sol)#eol)#som)0# col)0#sov)0#eoh)0#cap)#sl)X# < )b#8) P0)# )# )B #req)u#rsp)u#Xuri)# ^ )# ?)# 9E)# L<)0#B  0# 0# 0#<TH NI# 6 J# K# fL# M# b N# O# `%Q # 0R# S#$ S#( #"T0#, 6T0#0 U#4 U#8 V#< WC#@ Xt#H ;Z#L [#\ ;]#l g_#| o`# b# 7b# c#  d# Le# f# g# ;g# c!h# z h# h# i# j# Fk#idm# n0# n0# o0# p0# q0# vr0# Vr0# gs# 4 t# fu# w0# w0# x0# yq# {0# {0# |0# t|0# }0# ~# 0# < 0# t# t# $# `%DQ # N # # 6 # # A# T# J# I##,aclC#0 C#8 sC#@ C#H >;g##Psrv#\  #` #d  $#h S# # # [# # 0# Ô# Ĕ# # Ɣ# 1ǔ# qȃ# # Pʔ# ˔# *&# # fΔ# C# ^$%#id# C# ܔ# ܔ# Kݔ# 0# u0# T0# 0# # # 0# P0# < 0# #"0# 0# 50# ## 5# # 5 # 0# 0# q# 0# 0# 0# t0# 0# 0# 0# t# t# #cap# # ;# g# o# N #  7"#  7"# H{# q{### #o### r#^r#d#)#gn&#,n&# #a #[ #y t&#B  t&# # ##`&##o#0#v 0# "#"#HHL ( ( C# (!| #srv("# D' '# x'|# O '|# '|# '# Z'# '#$ 3#'[#( & '[#, &'[#0 't#4 't#<t 'px' #sv'NJ# E'Ȃ# 'Ȃ# L<'0# iid'ʔ# 'ʔ#sid'ʔ# ' 'n# 'iid'Д#px' #buf'0#sid'0# ptr'Ԕ#bol'Ք#!' %' 't '֋ !!  3!| '!J!| 9! !!acl * +C#u ,#)? -C#  .# /0#W!"A? > ?C#" @C#pol A# B0#J+ C#7"p7 ;4un5H in6P"Kp2u7"#" ,u \vH#t0wH#t1wH# 5x# Ny# z# {{#$ |#(I# |#len0#pos0# sid0#srv#oe #src#buf7 #g#be  u#  X0# :C## srv## G # 6 ##XactP"#bckP"#,$actH#bckH#$ # # o # ># # # # J #map## W##, ##  %# e4 %# 5 %#  %#  %# %$%  є# 0Ҕ# 5Ӕ# 7Ԕ# <Ք# ֔# +ה# ؔ#&*  n&# '# W(# .3)# L<*# -+'# ,'# N-&#%n&  Nn&# u# X#len # !# wA"# & & &B "&#4 #u&C#@&#be&# !'?(!"C#@#&#$# %#%&#'#L<(0#)# *#$'  N'# # #''R  N'# # #'F(+Q +M# +N# +O# +P# )+;uid+<#gid+=# +># #"+?# +@# +A# +B# (+C# T+D# +E#$ +F#( +G#, %+H#0 H+I#4 q+I#8 +J#< +J#@  +K7"#D  +K7"# @+Q(# +R # a+S#$wU$U%)t U&u%) U'sig%"*( AU'sig(J*PlU)sig(* p\U)sig*p V+*sS(*L?`pU)sig>(J,5p1U,#W,V*iQ-Pp-l.tmp-!h/I+-S/}+P*cur4 P-, 5V-5S0+J,ء1],2j,ء1},1,1,0+J,\b1],2j,\b1},1,1,0,J,1],2j,1},1,1,2J,1],2j,1},1,1,3j,n4m3, -4+4G+4>,(. @U*p W*p0 P*hn&S-@n&V*sV- p*lP-S-@&S- &V*exprS-rP*acl!S-j!V-.S- .V*rdr.S-.V*uap&V*ua&l-'S*iS/-p5hh/.5hh/&.5hh/<.5hh/R.5hh0./71/2/71//29/71J/2T/6a/P0.s/7[6/Q2/Ĩ1/2/Ĩ1/2T/1a/&&7/"t8tt79/t8tt7T/t8tt9m/]:l\m/9/8tt7/ ~t8t}t7/} vt8tut;/4 \U)sig[V*p]S<0D j\U-Nkt=1$`DU,#, *errV-S-%`-%1\/0*w|h/0*pxX S*retYP-{ ZV/0(*retP+H-P1>""1>"1>"1>$L>1D1 >I$M>1>>>  >] %o>%t1*>%u> %v> +Z 1? >,Q1@`%- >-C>-D>.;0Anow.<|>.>|> %BqF(LBlXCpidmBnN>7+[B7 BwConewB2w ;B > /#> 0$>y1#> 2>Q0>RR0>U0>r V>Wm/B[kXDXDXD)X 3 DE3NQ gPh J0?>x :5@int?Gn#p# L}#(}#h#E# #<1 #'N# H H< /0PU ptr}Q h0S 'h߱U%S'&NP i(hQA4U3V 3HS idx50P ~<~ wU;RL;}W idx=0PX>HSGU]C%C% JUIp IHW idxK0PXLHS]R%R%ֲhS[gUZW i\0VX]HShhg ph }pUinQ:VoutSfkintG @? s@ vv 2h ?>x "%:5&^@intm6%>:?:A:3C|DS?G % - -K< s#- # # #  #y #M #7 #z #  #$g #( #, #0 #4. s#8 s#< #@ "3#D` #e#F $#G` (#H 1#L 7#T3 8#XS :s#\ <#` b ) M #  # s#    3-n-#p-# B G Q$3+  _# #   !_# z# #  w    b  #  m  M # # # bit s#u32"%A* F+##key,m#x D0wq1x#rq2x# 6 3s#0 4s#4 5$#8 V 6#< 7s#@ '8H 6 I%# J%# JK#fdLs# L<M%#expN%# 2O # 2P # 1Q # 2R #$ibSY#(obSY#, T%#0 U#4*Y S L<}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0  %#4 s#8 &|#< ,#@ ,#A L#D H#L & #P #T #XppYv _ ] auid^I#gid_3# T`># buxaLfdMs# 6 Ns# Os# ;P# Q # SRs# #"Ss# T%# NU # V# >'W # X$# ^$Y # Z#  [%# nb# 'c# TQ um # 2ns# os# ps# h q_# rT# ss#$ 1t #( 2u #, Kv! #0 w! #4 x! #8 wy! #< 7z#@ 4{s#H |#L ss s  ! s  H  Cf A #b BY#  ?cb C # J D# 6 E,#ev F,# W G #  HT# ' j 1< ]  ^# != _ #set ` #clr a # = b # = c #rem d #clo e # 1 f # 5 g #$ 8> h #( " i #, C j #0 u k#4 & ls#8 s s s      s   s     8 ^ٴU S] /U. S >s ]U = P? S Ls`U K PM S 'ZsUY S( js=U i Pk S^ x@}Uw Q !h|-  U  P ϶U  R"Ķ!h- BsжU  S#errsV)s cU  S#errsV_spU  S#errsVnsU  S#errsV$" $ $] o $ tH $ us % $QTOFۻqh J0?int>x :5@?G N#>#}#R N#># }#* %n&># '}#W(}#.3)># L<*>#-+#,#N-# U  V uS 7[ 4 2ݸ  E%%%}PҸ E*%*}P@[U ? uri?}S uASB}V nC> SQ QE5\`U [  \[} u]S^}V l j>uU t  t>P uvRU   >P uRB U   } uW}V "> >-SVBp e Ku  ]% %  ۻU   }V uW\}VSpoutѻ Ż ݹP_ ]% %/2 /h J"0?_ B>x "0:5&t@2B\5intm60>P?PAP3C|Di?G6S^ U 02Io40Y1 <x nR#a "7 $P B G Q8F* $D$E#V$F#^ 7  J G#  r= J$$I_+ +#_# o !+###  w+#G# ]## B d r s#G t # u# v#  w #6)n!  +#!#  k  -L - K<# - #  #  # # y# M# 7 # z# #$ g#( #, #0 #4 .#8 #< #@ "I#D ` #{#F $#G `(#H 1#L 7/#T 38/#X S:#\ <#`/b) M## #Y  R  3 b#  E  M# # # bit#u32"0yA*F+#key,E#n#p#y - y#ref!#:x D0wq1P#rq2P#6 3#04#45P#8V 6/#<7#@JJJ:4#wl #xL##yy##z0# M #{0#%#|0#p#}0#0 #~0#L<#0# -#0#$u##(   '8H6 I0# J0#JK/#fdL# L<M0#expN0#2O#2P#1Q# 2R#$ibS. #(obS. #, T0#0U/#4. SL<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8& #< B#@B#Ab#DH#L& #P# #T) #X] P-tstru#lenv#n n . t   zy#Ly#x J#z#fe#be## L<#$ 0#(req. #,rep. #0si #4i o#\"o#k#srv## # ) #txn#2 #fT#; #E/R # #Í##@0#]  : ] m auid^#gid_#T`# buxa:  LfdM#6 N#O#;Po#  Qt#SR##"S#T0#NUz#Vy#>'W#XP#^$Y#Z/# [0#nbm #'c#t TQum#2n#o#p#h q+# r # s#$1t#(2u#,Kv#0w#4x#8wy#<7zy#@4{#H|y#L    t CfA#bB. #B ?cbCB#JD/#6 EB#evFB#W Gd#H # R zp7;46un5jin6Kp2u7R# L#(##[# y#V * !a!^/#!_%#:!`%#!az +N ,z#+ -#Y .#s /# 5 *1 #'# '8len'90#cr':0#N';0#\ 'Cv'D\#0 'E#'F#P''G#0'H# &   Y Y    o . L   &b &l&ݟ#m_l&ޟ#u&ߟ#u_l&ߟ# v&#v_l&# `&l&#v_l&#c&#c_l&# r&#r_l&#}&rq&st& @& &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap& #sl&`# < &b#8&P0&#& # &4 #req&}#rsp&}#Xuri&#^ &#?&#9E&#L<&0#B 0# 0#0#<THNI#6 J# K#fL# M#b N#O#`%Q#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<Wy#@XJ#H;Z#L[#\;]#lg_#|o`#b#7b#c# d#Le#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gsP#4 t#fu#w0#w0# x0# y#{0#{0#|0#t|0#}0#~#0#< 0#t# t#$#`%DQz#N ]#]#6 # #A#T#J#X!#,acly#0 y#8sy#@y#H>;v!#Psrv#\ #` #d "#hS# ##[##0#ß#ğ##Ɵ#1ǟ#qȋ# #Pʟ# ˟#*̞###fΟ#y#^$##id#y# ܟ# ܟ#Kݟ#0#u0#T0#0# ##0#P0#< 0##"0# 0#50##]#5]##5 #0# 0# #0#0#0#t0#0#0# 0#t# t##cap##;#g#o#N# z# z#H{#q{# # # # o# # # z# ^z# d# )# g## ,##  # a # [ # y ## B  ##  #  # # `## # o# 0# v 0#  #  #HT %% y#%!n #srv%"# D #x#O # ##Z#  #$3#[#(& [#,&[#0t#4 t#< |px#svǒ#Eȍ#ȍ# L<0# iidʟ#ʟ#sidʟ#  ͤ# iidП#px#buf0#sid0# ptrԟ#bol՟# %|֓ )  ; n / R n A    ,u\v#t0w#t1w#5x#Ny#z# {{#$|#(X!#len0#pos0# sid0#srv#oe#srco#buf) #v!beu ! X0#:y# ! srv!#G #6 # !Xact_ #bck_ #, "act#bck# ###o #># ###J #map!# W!#, !# ##e4##5####### # # џ#0ҟ#5ӟ#7ԟ# <՟# ֟#+ן#؟#*# # # #4 ! $83U"n7[Q# 7 #0 7$pos9S!p$(@oU"dst'R"src'S#0 'Q%)V!$NpU"nM[Q# MS#0 MR"altMP!%W%U"strVS$suXjY%)YP&'__s[/j!F%oBU"snR!o%hPU#uQ!%U#uQ!&&U"strS$sapY$cP%RV(˗)H&'__s/1&$0IB'__u&'__c*|&&IZ+&,&IZ+&+&+'-&v|$__vIP&$he'P&.&n/m.' -/+/G+ />,!(6#U"strգ#;ն( #cն(0z0$cV$sW%wٟS$len[P)''__s/'$0IB'__u('__c)O('__s/8($0IB'__u('__c)($errd,&+&1&P+'-(տ$he'P& '__v0]'(2)V00WU3s,)4R1,)R455)S5>)Q6H)T07sʣ'i0'j02a*C;`U3url:8h: 8;:&9\<S:cp<V;ret=9=Q9u>0l*J*a* 1s*W1*h)+*05*d5*`5*Q5*p5*\<*4X5*V&7s5*P&;__vbI=*/;>dst(??;ch;tmp*;tp*;cp@?B@;new *x x2+Qx U8I(uQ8 u 8vs3mapv+82wV&Kg9|R+ 2+@0U3s,+1+Q4p5+R6+>07s'i02],L0U3s3lenP,],1n,S1w,Q45,R6,J07sۣ7len۟'i02,0 SU3s3lenP,,$&1 -S1-Q45-V5'-R<0-6:-07s7len'i0'j0'k02-`U3sS3lenQ:iV:jR;k2-dU3sV3lenS3retP:iQ:jR2U.mpU3s3len 3retU.P:itVW:jlt2/&U8Y %S3ret%/P8%09'0V9'0W9(0p9>(0l9)0d&0H:j:0R0A, K// IA L-/3/ AI M-/A" R/A R/Atr/Au / B/@ / Ct/ /  h +06Gi%?>x :5&v@int3C|Dk?6 H -r -K<#- # #  #  #y#M#7 #z# #$g#(#, #0#4.#8#<#@"V#D` #}#F$#G`(#H1#L 7#T38#XS:#\<#`x 6 b)  M# # # 6  6 3n#p#4w l x}# y# zH# M {H# %|H# p}H# 0 ~H# L<H# -H#$ u#( 6  $ V+   # # 6  '8H 6 IH# JH# JK#fdL# L<MH#expNH# 2O# 2P# 1Q# 2R#$ibSE#(obSE#, TH#0 U#4E S L<}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0  H#4 #8 &#< O#@ O#A d#D H#L & #P #T #XtP-tstru#lenv#E t 6] Cf A#b BE#J ?cb CJ# J D# 6 EO#ev FO# W GZ#  H# Z U&Ubuf%ESmsg%r len%Vmax'   buf E'buf'- EUbufDES P-DVmaxF K kvUbjESposj endjWstrjr!lVlenmr RUbESpos endVstrrlen!W 1`IUbESposWstrrlen!V, $PUchkV 0 Sfmtr"#=$retP%u EUou pbEW QStol&"u &u & t & u 6' & Q & ;H(  + h J0?>x "0:5&i@intm60>E?EAE3C|D^~?G6S^ U 0BGQ8F u* D E# VF#+iu - / - K<~# - #  #  # # y# M# 7 # z# #$ g#( #, ~#0 #4 .~#8 ~#< #@ ">#D ` #p#F $#G `(#H 1#L 7#T 38#X S:~#\ <#`5  b ~)  M~# # ~#G@3Vtm,w $x~# y~# gz~# o{~# 3|~# G}~# +~~# _~# v~# #$ /#(2>o40Ya l   n# > +   # # # ! #  #  ##3w x ڨ# w#  ܍# x#7 b#   M# # # bit~#u32"0 ?A* F+#key, # dnd#pd#?   - ?#ref!d# x D0wq1#rq2# 6 3~#0 4~#4 5#8 V 6#< 7~#@ 4w l x:# y?# z0# M {0# %|0# p}0# 0 ~0# L<0# -0#$ u#(  '8!H 6 !I0# !J0# J!K#fd!L~# L<!M0#exp!N0# 2!O# 2!P# 1!Q# 2!R#$ib!S #(ob!S #, !T0#0 !U#4 !S L<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 ~#8 & #< 7#@ 7#A W#D H#L & #P  #T  #X # P-tstru#lenv~#4 4  :   z  ?# L ?# x #  y#fe #be #  ~# L< ~#$  0#(req #,rep #0si !#4 i # \" # k 3#srv )#  )# )# !#txn # 2 ~# f #  !# E/ !# w#  w#  ׆!# @ 0##   ] ) )n !  # !) #9 kl auid ^6#gid _ # T `+# bux a9  Lfd M~# 6 N~#  O~# ; P# Qs# S R~# #" S~#  T0# N Uy#  V?# >' W#  X# ^$ Y#  Z#  [0# n bl # ' c# s T Q u m# 2 n~#  o~#  p~# h q# rV#  s~#$ 1 t#( 2 u#, K v#0  w#4  x#8 w y#< 7 z?#@ 4 {~#H  |?#L  ~~~~s%Cf%A#b%B # A %?cb%CA# J%D# 6 %E7#ev%F7# W %GQ# %HV#Q ~p7;4un5 in63 Kp2u7\#&Q &M~# &N~# &O~# &P~# $&;uid&<~#gid&=~# &>~# #"&?~# &@~# &A~# &B~# (&C~# T&D~# &E~#$ &F~#( &G#, %&H#0 H&I~#4 q&I~#8 &J~#< &J~#@  &K#D  &K# @&Q# &R # a&S~# w  L# (# ~# P# ?#$ a ^# _%# :`%#a + N, # +-# Y.~# s//#   E 1 d# 'W#QQwE $8len$90#cr$:0#N$;0#  $Cv$D# 0 $Ew# $Fw# P'$Gw# 0$Hw# ] 8#!!!Y!Y ! !!o!.!L !  ##l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#Cst# @# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#ڦ#sl## < #W#8 J# P0#8# ## # #req##rsp##Xuri## ^ ## ?## 9E#~# L<#0# B  0# 0# 0#)<T H N I)# 6 J~# K~# f L~#  M~# b N#  O# `% Q# 0 R~#  S~#$ S~#( #" T0#, 6 T0#0  U~#4 U~#8  V~#<  W?#@  X#H ; Z3#L  [3#\ ; ]3#l g _~#| o `#  b)# 7 b)#  c#  d3# L ew#  f~# g~# ; g~# c! h~# z h~#  h~#  i~#  j~# F k~#id m#  n0# n0# o0# p0#  q0# v r0# V r0# g s# 4 t# f u)#  w0# w0# x0# yA#  {0#  {0#  |0# t |0#  }0#  ~J#  0# < 0#  i#  i# $ ~#`%D Q  y# N #  # 6 ~#  ~# A ~# T ~# J 3#  "#,acl ?#0  ?#8 s ?#@  ?#H >; ##Psrv )#\  ~#` ~#d  ##h S # #  ~# [ #  ~#  0#  ~#  ~#  #  ~# 1 ~# q # # P ~#  ~# * 5%#  # f ~#  ?# ^$ ٶ$#id #  ?#  ~# ~# K ~#  0# u 0# T 0#  0# J#  J#  0# P 0# < 0# #" 0# 0# 5 0# # # 5 #  # 5 ~# 0# 0# A#  0#  0#  0# t 0#  0#  0# 0#  i#  i#  ~#cap ~#  3# ; 3# g ~# o # N #  #  # H p# q p#  ~#  ~# ~# o ~#  ~#  ~#  # ^  # d ~# ) ~# g A%# , A%#  # a # [ # y G%# B G%#  ~#  #  ~# ` W%#  ~# o ~#  0# v 0#  q"#  q"#H/  " " ?# "!4 #srv"")#  D ~# x L# O L#  L#  # Z # #$ 3# P#( & P#, & P#0  i#4  i#<! px ƨ#sv )# E w#  w# L< 0# iid ~#  ~#sid ~#*!  j#! iid ~#px Ѩ#buf 0#sid 0# ptr ~#bol ~#! % ˜  ! *!!!4 !!4 !  q" , u \ v#t0 w#t1 w# 5 x# N y#  z~# { {~#$  |~#("   L#len 0#pos 0# sid 0#srv )#oe #src #buf # # be u 2# X 0# : ?#e# srv e## G ~# 6 ~#)#X act !#bck !#,# act #bck #$  ~#  ~# o ~# > ~#  ~#  ~#  ~# J )#map 2## W k##, ## $# e4 $# 5 $#  $#  $#$)$/%  ~# 0 ~# 5 ~# 7 ~# < ~# ~# + ~#  ~#*/% ;%W% g% "%AoU#fmt@/$%B&tmCH'%(%D(%P)%*now%*tm% A"P&WVpU#fmtU/$%W&tmXH'%(%D(%P"&j$U#outi&S#fmti/ $%k+&y~0eU#levx/V,z~S-@S%]}%%}%+A'~pU#fac/V,~S-%]%%%")U#pV.~ .1/S$,~O,~O,O%,)Y,_],~~,< ~P,V~,&),,,~W,~,OS/(,K<)P, ~R,S0(,1K<)V11w~P'G)2X)-&tm'%&(%(%P&)6)6)B) 3d)~4K<)5C*:?U6s>4 S7pn@7feAW7beB~1|C~1D~V1tE~7tmF~8*%(%~(%P0,*@P9__vi>-ju9__vj>:"&:&:&:%tw*:%u~: &Z~*;:Q*:'=L:&V:&Wx "0:5&i@27intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fp* !D!E#V!F#    b#  p  Mx### bit#u32"0'A*F+#key,#LnL#pL#'{ - '#ref!L#4 wl x# y'# z0# M {0#% |0#p }0#0 ~0#L< 0# - 0#$u #( * 02>o40Y5 @| nV#$>+ ##  !###  wWڇ#K# a#W# g7  -r -K< #- # # #  #y #M #7 #z #  #$g #( #, C#0 I#4. #8 #< #@ ">#D` #p#F $O#G` (_#H 1#L 7#T3 8#XS :#\ <e#`b C) M C# I# # r _  u 3x D0wq1#rq2#6 3#04#45#8V 6#<7#@u '8 H6 I0# J0#J K#fd L# L< M0#exp N0#2 O#2 P#1 Q# 2 R#$ib S- #(ob S- #, T0#0 U#4-  SL< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8&  #< 7#@ 7#A W#DH #L& #P " #T ( #X\ P- tstr u#len v#m m - s    z '#L '#x # #fe #be # # L< #$ 0#(req - #,rep - #0si #4i #\" #k #srv # # # ,#txn #2 #f W# >#E/ U# ‚# Â# #@ 0#\  9 ]b )n!  #!b # r k auid^1#gid_#T`&# buxar  LfdM#6 N#O#;P#  Q #SR##"S#T0#NU #V'#>'W #X#^$Y #Z# [0#nb #'c# TQum #2n#o#p#h q# r|# s#$1t #(2u #,Kv #0w #4x #8wy #<7z'#@4{#H|'#L         Cf A #b B- #z ?cb Cz#J D#6 E7#ev F7#W G# H|#   L#(##P# '#{' a^#_%#:`%#aw+N,w#+-}#Y.#s/*# 2'1 L#'#$8len$90#cr$:0#N$;0#Y $Cv$DY#0 $E#$F#P'$G#0$H# #YY  o.L   #_#l#݉#m_l#މ#u#߉#u_l#߉# v##v_l##]#l##v_l##c##c_l## r##r_l##z#rq#st#@# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap##sl#]# < #W#8#P0#### #3 #req#z#rsp#z#Xuri##^ ##?##9E##L<#0#B 0# 0#0#<THNI#6 J# K#fL# M#b N#O#`%Q#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<W'#@X#H;Z#L[#\;]#lg_#|o`#b#7b#c# d#Le#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t#fu#w0#w0# x0# y<#{0#{0#|0#t|0#}0#~#0#< 0#i# i#$#`%DQ #N a#a#6 # #A#T#J# #,acl'#0 '#8s'#@'#H>; #Psrv#\ #` #d b!#hS# ##[##0#É#ĉ##Ɖ#1lj#qȈ# #Pʉ# ˉ#*"##fΉ#'#^$c"#id#'# ܉# ܉#K݉#0#u0#T0#0# ##0#P0#< 0##"0# 0#50##a#5a##5 #0# 0# <#0#0#0#t0#0#0# 0#i# i##cap##;#g#o#N# # #Hp#qp### #o### w#^w#d#)#g"#,"# #a #[ #y "#B  "# # ##`###o#0#v 0#  # #HxW "" '#"!m #srv""# D  #x G#O G#  G# #Z #  #$3# P#(& P#,& P#0 i#4  i#< px #sv Ǖ#E Ȃ# Ȃ# L< 0# iid ʉ# ʉ#sid ʉ#  R# iid Љ#px #buf 0#sid 0# ptr ԉ#bol Չ# %    ֖ ,  >m 2Um D p7 ;4un59 in6Kp2u7b#  ,u\vx#t0wx#t1wx#5x#Ny#z# {{#$|#( G#len0#pos0# sid0#srv#oe#src#buf( # be u X0#:'#! srv!#G #6 #=!Xact#bck#,b!actx#bckx#Q"##o #># ###J #map # W!#, =!# ]"#e4]"#5]"#]"#]"#]"Q"" щ#0҉#5Ӊ#7ԉ# <Չ# ։#+׉#؉#*" " # #3 !_#T U"x SS#_#3H$p##z#3<$#%z#} v&tu'#](l\#)#0DU*t/S+,5P!?%yPSU"Nx V,x zW-eb{#S..$?%z}$P%/Z%P.r$e%$v%#%$%#%/%P$%.$%$%#%$&01 &R#%/%P$%.$_#$p##z#$#.%&$)&/4&P.&%@&&$M&#Y&2S$j&$s&%e%f_&t1^&t2^%%7#( 62%6%3 52%%3I(3GB0%%IC#(lB#2&^T%3FS%4tU%@&qk( j&nowj'Y&(x %}&h&tg&fg0!'$` U"N -tS-eb#V,;0W,p.)'% $%#% $&0 1 &P#%/%P$%.U'' $'#z# /#P.l'@&w$M&.''$'$'#e%$v%#%$%#%/%P$%%'&t% (&t1&t25(`U6}(*7__sf( $0 > 77__u(7__cw+7__s( $0 > 77__u(7__cw<((8"(g8(8 t)8 u ,)9 8%Q)8&;0:now&x :5&S@int3Cz|DH?G6Sz^ Uz %* DE#VF# $ 36+   # 6# F  -Q - K<h# - #  #  # # y# M# 7 # z# #$ g#( #, "#0 (#4 .h#8 h#< o#@ "3#D ` #Z#F $.#G `(>#H 1#L 7#T 38#X S:h#\ <D#` b") M"#(# h#Q >  T 3" '8H6 I%# J%#JK# fdLh# L<M%# expN%#2O4#2P4#1Q4# 2R4#$ ibS#( obS#, T%#0U#4..T" SL< }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4 h#8& #< ,#@ ,#A A#DH .#L& .#P #T #X:  ]hhC fA# bB#_ ? cbC_#JD#6 E,# evF,#W Go#H# o  -h`Utv1,Qtv2,Skhtv1tv28h8zUtv8SQ mshQ6hUtv15Qtv25Rhtv1tv2Ah Utv1@Vtv2@W#0*htv1)tv2)K: zUtv1JVtv2JS,;E[ ![:tv1Ztv2Z J:tv1Itv2I"retK: U:Utv1TWtv2TSX #! a:Utv1`Stv2`R ($P: i8 ]Utvh8VQhRinchP: .WL W c p w8tvv8%Qvincv Grh`Utvq8SQqVincqQ ac    Fhtv8%Qincd {8Utv1zRtv2zPtvz8Vd v    8tv1tv2tv8- :8 Utv1Stv2Rtv8Q - -I? K W d 5Iv   c P]t c 98tv1tv2tv8 so8tvn8 hUtv1Qtv2R    htv1tv2C VhUtv1Qtv2RC T _ k Uhtv1tv2&MU_hSh '/]'p'h(ç(?: "QL W c MQe^i9M^iuuhtv1tv2x8tvx8$UthSaQ)rv])p͓p)cnthl  *" F* *t,*uh P+ * Q?, %$,%<,%0-now,4,( +h J0?>x :5&^@int3C|DS?G 0 -a -K<s#- # #  #  #y#M#7 #z# #$g#(#, #0#4.s#8s#<z#@">#D` #e#F$#G`(#H1#L 7#T38#XS:s#\<#`g b)  M# # s#s  l  3  >+   # # +  '8H 6 I0# J0# JK#fdLs# L<M0#expN0# 2O # 2P # 1Q # 2R #$ibSZ#(obSZ#, T0#0 U#4+Z S L<}0#rex~s#wexs#rtos# wtos#ctos#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 s#8 &}#< 7#@ 7#A L#D H#L & #P #T #XqqZw ` ]ssCfA#bBZ#6 ?cbC6# JD# 6 E7#evF7# W GF# H# F +1<] ^# !=_E#set`E#clraE# =bE# =cE#remdW#cloeW# 1ft# 5g#$ 8>h#( "i#, Cj#0 uka#4 &ls#8@s@s s+W@KnnsL]snznB%MUfd$sS)1PUg0ap2sVg|]5%5%IN>sUp?sQbp@nVuLWXUbpYnpZsVsis`7UouthpjsS P'ksh NksW Y4lspbpmnl![s@U"""#] L#8s] J L #S: `#n ]#s# sD# s@ $ " Q % U."h ?>x  "%:5@intm 6% >: ?: A:h?G % BGQz $  n $# p $# 4w l x# y# z%# M {%# %|%# p}%# 0 ~%# L<%# -%#$ u#(  23o 4%Y    n#3 T+   # T#d  ! # o# #w   # #  # #, ))n !  # !)#9k ap7 ;4+un5in6 zKp2 u79# b#z M### bith#u32"% 1A* F+# key,# x D0 wq1# rq2# 6 3h#0 4h#4 5#8 V 6#< 7h#@1 a uid ^# gid _# T `#  bux a  L fd Mh# 6 Nh#  Oh# ; Pd# Q# S Rh# #" Sh#  T%# N U#  V# >' W#  X# ^$ Y#  Z#  [%# n b# ' c#  T Q u m# 2 nh#  oh#  ph# h q # r#  sh#$ 1 t#( 2 u#, K v<#0  w<#4  x<#8 w y<#< 7 z#@ 4 {h#H  |#Lhhh,<h,Q Mh# Nh# Oh# Ph# ; uidh# #"?h# @h# Ah# Bh# (Ch# TDh# Eh#$ Fh#( G#, %H#0 HIh#4 qIh#8 Jh#< Jh#@  Ka#D  Ka# @QB# R# aSh#    h# H!h# & "h# N# # [ & XUret' (p@__p5S~ I`UpH S VUpU R d"U  !"V# ]*# ]#h]#h]%10h J0?>x "0:5&i@\5intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fp*  D E#V F#|  a^#_%#:`%#a9e jh#ai#Jj?+N,?#+-E#Y.#s/v# K 2>o40YP [ nq#$>+ ##  !### - wrڢ#f# |#r# 7  -  - K<# - #  #  # # y# M# 7 # z# #$ g#( #, d#0 j#4 .#8 #< #@ ">#D ` #p#F $p#G `(#H 1#L 7#T 38#X S:#\ <#`bd) Md#j# #-  &  3 b#    M# # # bit#u32"0MA*F+#key,#r n r#p r#M - M#ref !r#x D0wq1$#rq2$#6 3#04#45$#8V 6#<7#@4wl x #yM#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u#(   '8 H6 I0# J0#J K#fd L# L< M0#exp N0#2 O#2 P#1 Q# 2 R#$ib S #(ob S #, T0#0 U#4  SL< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& #< 7#@ 7#A W#DH #L& #P #T #X1 P- tstr u#len v#B B  H    z M#L M#x # #fe #be # # L< #$ 0#(req  #,rep  #0si #4i #\" #k -#srv # # # #txn #2 #f # #E/ # w# w# n#@ 0#1   ]7 )n!  #!7 # G k z auid^1#gid_#T`&# buxaG  LfdM#6 N#O#;P#  Q#SR##"S#T0#NU#VM#>'W#X$#^$Yp#Z# [0#nbz #'c# TQum#2n#o#p#h q# r# s#$1t#(2u#,Kv#0w#4x#8wy#<7zM#@4{#H|M#L      Cf A#b B #I ?cb CI#J D#6 E7#ev F7#W GY# H# Y p7;4un5 in6-Kp2u7_# L#(##P# M#*-1 r#'?#99-#8len#90#cr#:0#N#;0# #Cv#D#0 #Ew##Fw#P'#Gw#0#Hw# E "   Y Y    o . L   " "l"݉#m_l"މ#u"߉#u_l"߉# v"#v_l"# "l"#v_l"#c"#c_l"# r"#r_l"#"rq"+st"@" "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ڎ#sl"# < "W#82"P0" #"# " #req"#rsp"#Xuri"#^ "#?"#9E"#L<"0#iB 0# 0#0#<THNI#6 J# K#fL# M#b N#O#`%Q#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<WM#@X#H;Z-#L[-#\;]-#lg_#|o`#b#7b#c# d-#Lew#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs$#4 t#fu#w0#w0# x0# y<#{0#{0#|0#t|0#}0#~2#0#< 0#i# i#$#i`%DQ#N |#|#6 # #A#T#J-# #,aclM#0 M#8sM#@M#H>; #Psrv#\ #` #d !#hS# ##[##0#É#ĉ##Ɖ#1lj#q# #Pʉ# ˉ#*###fΉ#M#^$ٞ"#id#M# ܉# ܉#K݉#0#u0#T0#0# 2#2#0#P0#< 0##"0# 0#50##|#5|##5 #0# 0# <#0#0#0#t0#0#0# 0#i# i##cap#-#;-#g#o#N# # #Hp#qp# # # # o# # # ?# ^?# d# )# g)## ,)##  # a # [ # y /## B  /##  #  # # `?## # o# 0# v 0# Y # Y #H !! M#!!B #srv!"# D  #x G#O G#  G# #Z #  #$3# P#(& P#,& P#0 i#4  i#<  px Ɛ#sv #E w# w# L< 0# iid ʉ# ʉ#sid ʉ#   x# n iid Љ#px ѐ#buf 0#sid 0# ptr ԉ#bol Չ# % ˄    B B  Y  ,u\v#t0w#t1w#5x#Ny#z# {{#$|#( G#len0#pos0# sid0#srv#oe#src#buf # beu ! X0#:M# M! srvM!#G #6 # x!Xact#bck#, !act#bck# "##o #># ###J #map!# WS!#, x!# "#e4"#5"#"#"#"" # щ#0҉#5Ӊ#7ԉ# <Չ# ։#+׉#؉#*# ## ?# O# !!$o0U"dstW"src "strvV#g!$$Bp%#{&len#S&num#P'X${/7Q$/7P%$(2'p(3'$ !b$$EvU"strDvS&errFvV!$UfvU#d$S#+dER#YeR#sevV)expg?*&errjvP?+,K$$ >+L$% ~+IM$ '% ,%+"F%+F%+ tf%+ u %- +$Qy%`c6qh J0?>x  "0 #[: %m5 &@\ 5intm 60 =b >E ?E @P AE BE3 C| Dt?G6 S^ UE lf q  0 '-s '-K<(#-( #( # ( #  (#y(#M(#7 (#z(# (#$g(#((#, (`#0(f#4.(#8(#<(#@(">#D` (##F($l#G`((|#H(1P#L (7f#T3(8f#XS(:#\(<#`  7 f b(`) ( M(`# (f# (#)s | "  3BGQ8F$* !D !E$# V!F/#2>o40Y .  n#$[>m+  9# m# }   !9# # #  w  9# #  #  # 7 rr s# Gt# u# v# w#DT"3 "4# "5# "6# "7# ~"8# "9# ":#,#, #-# Q#.# #/# #0# Q0X&% &&# &'># u&)# &-# x&.# &/# &0# &1# 3&2>#( &4#, &8:#0 >&;E#4 |&?$#8 &@[#< &A$#@ &B[#D <&C$#H &D[#L &F[#P &G[#T t  b t#  Q  M Y# # # bit #u32 "0A * F +#key ,#- n -#p -#\  - #ref !-#x D 0wq 1#rq 2# 6 3#0  4#4  5#8 V 6f#<  7#@\~ 4w l x# y# z0# M {0# %|0# p}0# 0 ~0# L<0# -0#$ u~ #(   \ '8+H 6 +I0# +J0# J+Kf#fd+L# L<+M0#exp+N0# 2+On # 2+Pn # 1+Qn # 2+Rn #$ib+S #(ob+S #, +T0#0 +Uf#4h h  \  +S L< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$ > 0#(  0#, 0#0  0#4  #8 & #< 7#@  7#A m#D H h #L & h #P  #T #Xt  P- tstr u#len v#       z ,# L,# x ,# ,B#fe,#be,# ,# L<,#$  ,0#(req, #,rep, #0si,!#4 i ,}# \",}# k,#srv,# ,# ,# ,!#txn,# 2 ,# f,# ,!# E/,!# ,# ,Í# ,{!# @,0#  ] )n !  9# ! #  k5 auid^#gid_# T`#H buxaOLfdM# 6 N# O# ;P}# Q<# SR# #"S# T0# NUB# V# >'WX# X# ^$Y^# Zf#  [0# nb5# 'c#< TQ umd# 2n# o# p# h q9# r.# s#$ 1tX#( 2uX#, Kv#0 w#4 x#8 wy#< 7z#@ 4{#H |#LOHXH t <t*Cf*AX#b*B #  *?cb*C # J*Df# 6 *E7#ev*F7# W *Gr# *H.#   r  L# (# # [# # a ^f# _%# :`%#a+ N,# +- # Y.# s/#  @ 1 -# 'R#LLr@/8len/90#cr/:0#N/;0# /Cv/D# 0 /E# /F# P'/G# 0/H# X3.YY  o.L   ..l.ݟ#m_l.ޟ#u.ߟ#u_l.ߟ# v.#v_l.#.l.#v_l.#c.#c_l.# r.#r_l.# .rq.>st.@. .0#sol.#eol.#som.0# col.0#sov.0#eoh.0#cap.#sl.# < .m#8?. P0.3# .# . #req. #rsp. #Xuri.# ^ .# ?.# 9E.# L<.0#vB  0# 0# 0#<TH NI# 6 J# K# fL# M# b N# O# `%Q# 0R# S#$ S#( #"T0#, 6T0#0 U#4 U#8 V#< W#@ X#H ;Z#L [#\ ;]#l g_#| o`# b# 7b# c#  d# Le# f# g# ;g# c!h# z h# h# i# j# Fk#idm# n0# n0# o0# p0# q0# vr0# Vr0# gs# 4 t# fu# w0# w0# x0# y# {0# {0# |0# t|0# }0# ~?# 0# < 0# # # $#v`%DQ B# N # # 6 # # A# T# J# ##,acl#0 #8 s#@ #H >;$#Psrv#\  #` #d  $#h S# # # [# # 0# ß# ğ# # Ɵ# 1ǟ# q# # Pʟ# ˟# *̠&# # fΟ# # ^$٪%#id# # ܟ# ܟ# Kݟ# 0# u0# T0# 0# ?# ?# 0# P0# < 0# #"0# 0# 50# ## 5# # 5 # 0# 0# # 0# 0# 0# t0# 0# 0# 0# # # #cap# # ;# g# o# N#  "#  "# H# q### #o### #^#d#)#g'#,'# }#a }#[ }#y '#B  '# # ##`'##o#0#v 0# e##e##H$Y - - # -! #srv-"#  D, ,# x,# O ,# ,# ,# Z,# ,#$ 3#,[#( & ,[#, &,[#0 ,#4 ,#<!,px,Ɲ#sv,# E,ȍ# ,ȍ# L<,0# iid,ʟ# ,ʟ#sid,ʟ#! , ,3#{!,iid,П#px,ѝ#buf,0#sid,0# ptr,ԟ#bol,՟#!, %,ˑ ,! ,! ! ! !! h ! !J"acl%*%+#u%,#)?%-#  %.#%/0#!"A?%>%?#"%@#pol%A#%B0#J+%C#"p7 ;4Dun5 in6"Kp2u7"#e# ,u \vY#t0wY#t1wY# 5x# Ny# z# {{#$ |#(# #len0#pos0# sid0#srv#oe#src}#buf #$be u&$  X0# :#Y$ srvY$# G # 6 #$Xact"#bck"#,$actY#bckY#% # # o # ># # # # J #map&$# W_$#, $# %# e4%# 5%# %# %#%%#&  џ# 0ҟ# 5ӟ# 7ԟ# <՟# ֟# +ן# ؟#&*  n&# '# W(# .3)# L<*# -+(# ,5)# N-&##&'  N'# u# X#len # !# wA"}#& '  .' "P'#4#u'#@'#be.'# P"%(?(!"#@#'#$# %#%&#'#L<(0#)# *#$[(2 $, $-#kw$.# $5(#([(($= $>#kw$?(# (%($(  N(# # #(5)R  N5)# # #(|)2Q 2M# 2N# 2O# 2P# *2;uid2<#gid2=# 2># #"2?# 2@# 2A# 2B# (2C# T2D# 2E#$ 2F#( 2G#, %2H#0 H2I#4 q2I#8 2J#< 2J#@  2K"#D  2K"# @2Q;)# 2RH# a2S#+S uT#valU0#capV0# W0# %,BU&str~'0BV(lBP(cP)N~)S)V~)RS(endW*m+,(ss}~,+-__sf.,,/,0,/,/ -/-.;,,/,0,/,/ -/-.o,,/,0,/,/ -/-,,%+(__v>P1(__v>P+,-__sf2(he"-P3,n4m3"- -4+4G+4>,5-U6`%V7capQ6(6J+7arg68msgS0-PY/-9-2:`%154 U6(6' 6d;7inv+U.;]%;%,{.;] %; %,.;]#%;#%,.;]&%;&%,.8E;])%;)%,/IV;],%;,%,9/;]/%;/%,_/;]2%;2%,/;]5%;5%,/;]8%;8%./,,/,0,,/,/ -/-,08E;]C%;C%.90,et/,0,et/,/ -/-,0;]N%;N%1;HN<NP.0,/,0,/,/ -/-+0<f4P,1;]Y%;Y%1;HY<YP.M1,;J/,0,;J/,/ -/-+e1 <v4P,1kx;]e%;e%,1;]u%;u%+1P__s2f04/4?48:`%75ZG `U6(F6'F 6d;F7invF<H]<IS8errJP8rcK}8valL0~+5;]N%;N%,5Th;]P%;P%,6;]t%;t%.(6-/-.?64/4.c6Z5@Z~@[~,6~;]R%;R%,6;]T%;T%+6;]%;%,6"/;]%;%+Y7<B~<~,F7;]0%;0%28l2BS,7bq;]G%;G%,7y8lIBP,7;]]%;]%,7 ;]j%;j%, 8"/;]|%;|%,183E;]}%;}%,{8|;]%;%1|;H<P+80;]^%;^%+>>hdr_',b>6;]f%;f%160>hdrw'+>H< A P<5A S8fdA V8errB }<0C ,~,"?.;;]v%;v%,H?CS;]v%;v%,?v;]~%;~%1vM;]W%;W%,C0?;]a%;a%,C 3;]:%;:%,D7I;]:%;:%,$DM<[;V,LD;EB%<BP.D1[/D[0,/,/ -/-+D<}1 ;]%;%,D&3;]z%;z%,E7D;]%;%,.EHT;]%;%,JE K!<[S,fEK!!<[V,E!!;E%<P,E"";] %; %,EH#k#;]%;%1H#k#;H<P,$F#$;]%;%,JFQ$^$;]%;%,pFf$s$;]%;%,F$$;]%;%+(G08polS<@'Q,G$$;]%;%1$$;H<P1%%;]%;%,NG%%;]%;%,tG% &;]%;%,GW&e&;]%;%,G'';]%;%,G ((;]%;%, H"(/(;]%;%,2H7(D(;]%;%,XHL(Y(;]%;%,~H((;]%;%,H((;]%;%,H1)O);]%;%11)O);H<P,IW)j);]%;%,:I));]%;%.nI,**/,0,**/,/ -/-,ID+Q+;]%;%,IY+f+;] %; %+JX< }< PP,Je--;][%;[%1e--;H[<[P2p__vf>,HK //>__ve>,nKW/j/;]t%;t%,Kr//;]y%;y%,K//;]~%;~%,K//;]%;%,L//;]%;%,,L//;]%;%,RL/ 0;]%;%,xL0'0;]%;%,L/0B0;]%;%,LJ0]0;]%;%,L00;]%;%,M00;]%;%,6M01;]%;%,\M 11;]%;%,M%181;]%;%,M@1S1;]%;%.M,11/,0,11/,/ -/-+M8errP,N12;]%;%,@Nu22;]%;%,fN23;]%;%,N'393;]%;%,N33;]%;%,NL4_4;]C%;C%,N44;]*%;*%.2O,55/,0,55/,/ -/-.fO,55/,0,55/,/ -/-.O,55/,0,55/,/ -/-+O>w0,66/,0,66/,/ -/-+O8errP+P8errP+&P(8errP.ZP,l88/,0,l88/,/ -/-.P,88/,0,88/,/ -/-,P99;]y%;y%199;Hy<yP+"Q@>;]%;%1>>;]%;%,RZ?m?;]%;%, S?@;]%;%,0SAA;]D %;D %,VSB#B;]%;%,|SYBhB;]%;%,SBB;]%;%+S<0~,SGCVC;]%;%,TCC;]%;%,.T@DMD;]%;%,TTUDbD;]%;%.T,EE/,0,EE/,/ -/-.T,0F2F/,0,0F2F/,/ -/-,THH;]Z %;Z %+T <+[ !S+U( <+ !S,8UHH;]p %;p %+PUH <+q !S+hU` <+' !S,UII;] %; %+U <+ !S+U <+= !S,UJJ;] %; %+U <+ !S,"VjKwK;] %; %+:V <+ !S,`VLL;] %; %+xV <+ !S,VLL;] %; %,V0N=N;] %; %+V <+ !S,WOO;] %; %,(WePrP;]& %;& %,NWQQ;]< %;< %,tW1R>R;]R %;R %,WZSgS;]f %;f %,WkSwS;]f %;f %+W <+g !S,WSS;]~ %;~ %+X@ <+ !S, R2 8pxz m8srv{ VE)L?aEa EI)M?aE*tdaE*u aF E0QwaE  G`%-G>.HOH]H0]E1;0Inow1<E2V|)E72[E2\  Eb E3Rb 5bE]3E3E4Q0ER4R0E4U0Er 4V}E4Wb b ~H^9b b bb  *)M[c b cb )+w+c@ c)])$^)Q(O#Q2rq h J0?int>x "0:5&w@m60>S?SAS3C7|Dl?G6S7^ U7 0 B G Q8Fe* DE#VF#k 2Lo40 Yp {  n #$L+ ##  =!##=# M w  # ۆ# ܜ# # E  -@ - K<># - #  #  # # y# M# 7 # z# #$ g#( #, #0 #4 .>#8 >#< #@ "L#D ` #~#F $#G `(#H 1#L 7#T 38#X S:>#\ <#` b) M## >#M  F  3   b #  9   M #  #  # bit >#u32 "0mA *F +#key ,9#n#p#m - m#ref!#.x D 0wq 1D#rq 2D#6 3>#0 4>#4 5D#8V 6#< 7>#@>>>.4wl x@#ym#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u#(   '8H6 I0# J0#JK#fdL># L<M0#expN0#2O#2P#1Q# 2R#$ibS" #(obS" #, T0#0U#4" SL<}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#, 0#0 0#4>#8& #< E#@E#Ae#DH#L& #P #T #XQ P-tstru#lenv>#b b " h   zm#Lm#x ># #fe #be #># L<>#$ 0#(req" #,rep" #0si#4i #\"#kM#srv## # !#txn #2 >#fL#3#E/J# …#Å##@0#Q  . ]W )n!  #!W # g k auid^&#gid_#T`# buxag  LfdM>#6 N>#O>#;P#  Q #SR>##"S>#T0#NU #Vm#>'W #XD#^$Y #Z# [0#nb #'c# TQum #2n>#o>#p>#h q# r# s>#$1t #(2u #,Kv #0w #4x #8wy #<7zm#@4{>#H|m#L   >> >  >  CfA #bB" #o ?cbCo#JD#6 EE#evFE#W G#H#   L#(#>#^# m#J a^#_%#:`%#al+N,l#+-r#Y.>#s/e# 'x 1 #'#"8len"90#cr":0#N";0#N "Cv"DN#0 "E#"F#P'"G#0"H# !YY  o.L   !T!l!>#m_l!>#u!>#u_l!># v!>#v_l!>#R!l!>#v_l!>#c!>#c_l!># r!>#r_l!>#o!rq!st!@! !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!#sl!R# < !e#8!P0!#!# !( #req!o#rsp!o#Xuri!#^ !#?!#9E!>#L<!0#B 0# 0#0#<THNI#6 J># K>#fL># M>#b N#O#`%Q #0R># S>#$ S>#(#"T0#,6T0#0 U>#4 U>#8V>#<Wm#@X>#H;ZM#L[M#\;]M#lg_>#|o`#b#7b#c# dM#Le#f># g>#;g>#c!h>#z h>#h>#i>#j>#Fk>#idm#n0# n0#o0# p0#q0#vr0#Vr0#gsD#4 t#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~#0#< 0#w# w#$># `%DQ #N ##6 ># >#A>#T>#JM# #,aclm#0 m#8sm#@m#H>; #Psrv#\ >#` >#d W!#hS# #>#[#>#0#>#>##>#1>#q}# #P># >#*"##f>#m#^$X"#id#m# ># >#K>#0#u0#T0#0# ##0#P0#< 0##"0# 0#50###5##5 >#0# 0# 1#0#0#0#t0#0#0# 0#w# w#>#cap>#M#;M#g>#o#N # # #H~#q~# ># ># ># o># ># ># l# ^l# d># )># g"# ,"#  # a # [ # y "# B  "#  >#  # ># `"# ># o># 0# v 0#  #  #HL   m# !b #srv "# D >#x<#O <# <#7#Z7#  7#$3#^#(& ^#,&^#0w#4 w#<tpx #svNJ#Eȅ#ȅ# L<0# iid>#>#sid># ͘#iid>#px #buf0#sid0# ptr>#bol># % t ֋ ! 3b 'Jb 9 p7 ;4un5. in6MKp2u7W#  ,u\v#t0w#t1w#5x#Ny#z># {{>#$|>#( <#len0#pos0# sid0#srv#oe #src#buf # be  u X0#:m#! srv!#G >#6 >#2!Xact#bck#,W!act#bck#F">#>#o >#>># >#>#>#J #map # W !#, 2!# R"#e4R"#5R"#R"#R"#R"F"" >#0>#5>#7># <># >#+>#>#*" " " #( !0# >qqU"sQ!W#% >q2rU"sR#"d##d##t##u> #$ ##Q#%now$<<41!V։@r!h J0?>x  "0:5 &i@intm 60 >E ?E AE3 C| D^?G6 S^ U  0BGQ8Fe* "D"E#V"F# '-p '- K<(~# -( # ( # ( # (# y(# M(# 7 (# z(# (#$ g(#( (#, (R#0 (X#4 .(~#8 (~#< (#@ (">#D ` (#p#F ($^#G `((n#H (1#L (7#T 3(8#X S(:~#\ (<t#`   b(R) (M(R#(X# (~#p n   3  >+   # #    ! # # #  wF 6  7~#  8~#2>o40YF Q ng#ڏ#\# r## 7  b#  e  M# # # bit~#u32"0A*F+#key,e#n#p# - #ref!#Zx D0wq1p#rq2p#6 3~#04~#45p#8V 6#<7~#@jjjZ4 wl x# y# z0# M {0#% |0#p }0#0 ~0#L< 0# - 0#$u #(   '8$H6 $I0# $J0#J$K#fd$L~# L<$M0#exp$N0#2$O#2$P#1$Q# 2$R#$ib$SN #(ob$SN #, $T0#0$U#4N $SL<!}0#rex!~~#wex!~#rto!~# wto!~#cto!~#l!0#r!#w!# lr!#$>!0#(!0#, !0#0 !0#4!~#8&!7 #< !7#@!7#A!W#DH!#L& !#P!C #T!I #X} P-!tstr!u#len!v~#  N  7  !z##L##x #j## #fe##be###~# L<#~#$ #0#(req#N #,rep#N #0si#%#4i ##\"##k##srv# ## # # # #%#txn##2 #~#f#$##%#E/# &# #w##w##ש%#@#0#} = Z ] )n!  #! # k auid ^&#gid _#T `# bux a   Lfd M~#6 N~# O~#; P#  Q #S R~##" S~# T0#N U # V#>' W # Xp#^$ Y # Z# [0#n b #' c# T Qu m #2 n~# o~# p~#h q# r#  s~#$1 t #(2 u #,K v#0 w#4 x#8w y#<7 z#@4 {~#H |#L   ~~ ~  ~ <)Cf)A #b)BN # )?cb)C#J)D#6 )E7#ev)F7#W )G#)H#  1<)])^#!=)_#set)`#clr)a# =)b# =)c#rem)d#clo)e#1)f# 5)g#$8>)h#(")i#,C)j#0u)k#4&)l~#8~~ ~~~/p7;4un5Z in6HKp2u7#,Q,M~#,N~#,O~# ,P~# ,;uid,<~#gid,=~#,>~##",?~# ,@~# ,A~#,B~#(,C~#T,D~# ,E~#$,F~#(,G#,%,H#0H,I~#4q,I~#8,J~#<,J~#@ ,K/#D ,K/#@,QH# ,R #a,S~#&8len&90#cr&:0#N&;0#_ &Cv&D_#0 &Ew#&Fw#P'&Gw#0&Hw# %   Y Y    o . L   %e %l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#c%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st% @% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%#sl%c# < %W#8%P0%#%# %T #req%#rsp%#Xuri%#^ %#?%#9E%~#L<%0# L#(#~#P# #vS a^#_%#:`%#a +N,#+-#Y.~#s/# ^ S1 #'# {`%D #N r#r#6 ~# ~#A~#T~#J#!#,acl#0 #8s#@#H>;!#Psrv #\ ~#` ~#d \"#hS# #~#[#~#0#~#~##~#1~#qȴ# #P~# ~#*###f~#ϙ#^$]##id#ۙ# ~# ~#K~#0#u0#T0#0# {#{#0#P0#< 0##"0# 0#50##r#5r##5 ~#0# 0# 1#0#0#0#t0#0#0# 0#i# i#~#cap~##;#g~#o#N# /# /#Hp#qp# ~# ~# ~# o~# ~# ~# # ^# d~# )~# g## ,##  # a # [ # y ## B  ##  ~#  # ~# `## ~# o~# 0# v 0# !# !#HB 0# 0#0#  #! #srv" #  <T"NI #6 J~# K~#fL~# M~#b N#O#`%Q#0R~# S~#$ S~#(#"T0#,6T0#0 U~#4 U~#8V~#<W#@Xj#H;Z#L[#\;]#lg_~#|o`#b #7b #c# d#Lew#f~# g~#;g~#c!h~#z h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#vr0#Vr0#gsp#4 t #fu #w0#w0# x0# y1#{0#{0#|0#t|0#}0#~{#0#< 0#i# i#$~#! ,u\v#t0w#t1w#5x #Ny #z~# {{~#$|~#(!<#len0#pos0# sid0#srv #oe#src#bufI #!beu! X0#:# " srv "#G ~#6 ~# 7"Xact #bck #,\"act#bck#K#~#~#o ~#>~# ~#~#~#J  #map!# W"#, 7"# W##e4W##5W##W##W##W# K## ~#0~#5~#7~# <~# ~#+~#~#*# # # $T $D# #~#x#<#O #<# #<###Z##  ##$3##P#(& #P#,&#P#0#i#4 #i#<6%#px##sv#Ǒ #E#w##w# L<#0# iid#~##~#sid#~#M% ###%#iid#~#px##buf#0#sid#0# ptr#~#bol#~#%#%#˿$#6%#M% % % % & %!_& 1@rrU"be0S#K&_&[rar$p&%_&rr$p&&|&2'`%1(';!=~r2sU"s< P)pc>%R*2 >%V*u >%W* ?~p+ *B S%'rr,'S$'&''hj-tgj-fg0('!Y~@ssU"sX V* Z~W+ .` /pa%#''`sss,'P%'ss,'S$'&'| ;%-px;'' !,(P!tsuU"ss V)srvu S)msgvT h* w~W+ * z~d!v("!uwU"s V)srv S)msgT h* ~W!( wyU"s S)srv S)msgT h* ~W0)  yMzU1s S2srv S2msg T h3 !~W4A*y!M~Pza|U1fdL~V5j z50!z5 `{5!A{2tOjW2sP S#)'zz$'$'6) 2ret]~P7zz8 d~7zz9__vd06* 2sa7{{9__v>%A*||$R*$]*%i*||,z*P$*&i*!W~-nowV~'^$V~&*9 L~-nowK~'^$K~4%+i!~p|~U1fd~5j W}2len~S2tj`2s \3!~d3!h%'z}}$'$':i.T j~U1t j3B ~L2s W2saX2fd~S2rv~V5!~#+i./I,z.P,.R#+i.`x$z.$.#+i.$z.,.P#,i*,z*P$*#5,i*݀,z*S,*P#S,i.$z.,.P#q,i*ł,z*P$*#,i.(<$z.,.V6, 8!~#,i*<N,z*S$*#,i*N],z*P$*%.o$.$.;-9__vB>6H-( 3!I.V2retJ~P3L<J~H6-@ 3!h.V2reti~P3L<i~D%_&^p,p&P#-.#$.#-i*,z*P,*P;.†8!~#.i*†ц,z*S$*%.ц$.$.#5.i.$z.$.#S.i*,z*P$*%_&#5,p&P&.qk~' j~-nowj~&. u~-t1t~-t2t~<.` T-fdS~=/ %~։U2px'p2s( S9t)j3!*~l3`!*~h3!*~d#//L>/+X >/6r/x ?/V%/t{$/#/i*,z*W,*P%/$ 0&/K j/tj@/__p&/3j-tj<0'x jA"'$0eA'$0A] )oA)tQ0<A)u~ u0B A*Qd0A+;0Cnow+<<A+=<A,VA,\I Cone,^A,_0 D`%-AQ0ARR0AU0Ar VAW11p[&S%'`Y!h J0?int>x  "0:5 &w@m 60 >S ?S AS3 C7| Dl?G6 S7^ U7  0BGQ8Fe* DE#VF#  n # p #e - e# ref !#R4wl xR#ye#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$uX#( h n 2Lo40Ys ~ n#$ L+ ##  @!##@# P w#ۉ# ܟ## E  #-C #- K<$># -$ # $ # $ # $# y$# M$# 7 $# z$# $#$ g$#( $#, $#0 $#4 .$>#8 $>#< $#@ $"L#D ` $#~#F $$#G `$(#H $1#L $7#T 3$8#X S$:>#\ $<#`b$) $M$#$# $>#J  C  3 b#  6  M# # # bit>#u32 "0jA *F +# key ,6#x D 0 wq 1A# rq 2A#6 3>#0 4>#4 5#8V 6#< 7>#@j '8 H6 I0# J0#J K# fd L># L< M0# exp N0#2 O#2 P#1 Q# 2 R#$ ib S" #( ob S" #, T0#0 U#4"  SL<}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#, 0#0 0#4>#8& #< E#@E#Ae#DH#L& #P #T #XQ P-t stru# lenv>#b b " h   ze#Le#x # # fe # be #># L<>#$ 0#( req" #, rep" #0 si#4i  #\" #kP# srv## # !# txn #2 >#fL#3#E/J# …#Å##@0#Q  . ]W )n!  #!W # g k a uid^&# gid_#T`# buxag  L fdM>#6 N>#O>#;P #  Q #SR>##"S>#T0#NU #Ve#>'W #X#^$Y #Z# [0#nb #'c# TQum #2n>#o>#p>#h q# r# s>#$1t #(2u #,Kv #0w #4x #8wy #<7ze#@4{>#H|e#L   >> >  >  %C f%A # b%B" #o %? cb%Co#J%D#6 %EE# ev%FE#W %G#%H#   L#(#>#^# e# a^#_%#:`%#al+N,l#+-r#Y.>#s/h# 'x 1 #'#"8len"90#cr":0#N";0#N "C v"DN#0 "E#"F#P'"G#0"H# !YY  o.L   !T! l!># m_l!># u!># u_l!># v!># v_l!>#R! l!># v_l!># c!># c_l!># r!># r_l!>#o!rq!st!@! !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!# sl!R# < !e#8!P0!#!# !( # req!o# rsp!o#X uri!#^ !#?!#9E!>#L<!0#B 0# 0#0#<THNI#6 J># K>#fL># M>#b N#O#`%Q #0R># S>#$ S>#(#"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;ZP#L[P#\;]P#lg_>#|o`#b#7b#c# dP#Le#f># g>#;g>#c!h>#z h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#vr0#Vr0#gsA#4 t#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~#0#< 0#w# w#$># `%DQ #N ##6 ># >#A>#T>#JP# #, acle#0 e#8se#@e#H>; #P srv#\ >#` >#d W!#hS# #>#[#>#0#>#>##>#1>#q}# #P># >#*"##f>#e#^$X"# id#e# ># >#K>#0#u0#T0#0# ##0#P0#< 0##"0# 0#50###5##5 >#0# 0# 1#0#0#0#t0#0#0# 0#w# w#># cap>#P#;P#g>#o#N # # #H~#q~# ># ># ># o># ># ># l# ^l# d># )># g"# ,"#  # a # [ # y "# B  "#  >#  # ># `"# ># o># 0# v 0#  #  #HL  e#!b # srv"# D >#x<#O <# <#7#Z7#  7#$3#^#(& ^#,&^#0w#4 w#<t px # svNJ#Eȅ#ȅ# L<0# iid>#># sid># ͐# iid># px # buf0# sid0# ptr># bol># % t ֋ ! 3b 'Jb 9 p7 ;4un5. in6PKp2 u7W#  ,u\v# t0w# t1w#5x#Ny#z># {{>#$|>#( <# len0# pos0# sid0# srv# oe # src # buf # be  u X0#:e#!  srv!#G >#6 >#2!X act# bck#,W! act# bck#F">#>#o >#>># >#>#>#J # map # W !#, 2!# R"#e4R"#5R"#R"#R"#R"F"" >#0>#5>#7># <># >#+>#>#*" " " #( !R#"'0U"s&R#S#max(0V$&R%"60X# & ">U'#8"-U"p!Q$Ê%h!O$!ab 0U"srv`V"px` W#psb!Q(ppb!)cb S*$O$13+`$*0$j$KQ+{$,$o-$p-$l.j$F"1!/s1R#.$| ;!/px;$$ .$>/tv1$/tv2$$ <'1%!C U"sBV#pD p)#"E>W$@r)Mb P,1%Sr-B%S+K%.U%h/tg/fg0!%+"!YU0b S(p!1 #__pQ2"#%2#%2%t%2%u> %3 2&Q%4now<<5 P2Q02RR02U02r V2WX&A5 (e`"h J!0?>x "0:5&i@intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fe* #D#E#V#F# )-p )- K<*~# -* # * # * # *# y*# M*# 7 *# z*# *#$ g*#( *#, *j#0 *p#4 .*~#8 *~#< *#@ *">#D ` *#p#F *$v#G `*(#H *1#L *7#T 3*8#X S*:~#\ *<#`    ,  b*j) *M*j#*p# *~#3p,3$>+ ## "!##"#2w^6 7~# 8~#2>o40Y^ i n#ڧ#t# ܊##7 b#--}  M# -# -# bit~#u32"0A*F+3#key,}# n #p # - #ref !#rx D 0wq 1#rq 2#6 3~#0 4~#4 5#8V 6#< 7~#@ r'4"wl "x#"y#"z0# M "{0#%"|0#p"}0#0 "~0#L<"0# -"0#$u"'#(7  '8$H6 $I0# $J0#J$K#fd$L~# L<$M0#exp$N0#2$O#2$P#1$Q# 2$R#$ib$Sf #(ob$Sf #, $T0#0$U#4  7f $SL< }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 ~#8& O #< 7#@ 7#A W#DH #L& #P [ #T a #X P- tstr u#len v~#  f  O   z #L #x # #fe k #be k # ~# L< ~#$ 0#(req f #,rep f #0si s"#4i #\" #k #srv # # # "#txn #2 ~#f # "#E/ "# w# w# I"#@ 0# U r ] )n!  #! # k auid^&#gid_#T`# buxa  LfdM~#6 N~#O~#;P#  Q #SR~##"S~#T0#NU #V#>'W#X#^$Y#Z# [0#nb #'c# TQum #2n~#o~#p~#h q# r# s~#$1t#(2u#,Kv-#0w-#4x-#8wy-#<7z#@4{~#H|#L  ~ ~ ~-~ T+Cf+A#b+Bf # +?cb+C#J+D#6 +E7#ev+F7#W +G#+H#31<+]+^#!=+_#set+`#clr+a# =+b# =+c#rem+d#clo+e#1+f# 5+g#$8>+h#("+i#,C+j#0u+k#4&+l~#8~  ~ ~     ~~    Gp7;4un5r in6`Kp2u7#,Q,M~#,N~#,O~# ,P~# ,;uid,<~#gid,=~#,>~##",?~# ,@~# ,A~#,B~#(,C~#T,D~# ,E~#$,F~#(,G#,%,H#0H,I~#4q,I~#8,J~#<,J~#@ ,KG#D ,KG#@,Q`# ,R #a,S~#: L#(#~#P# #~ a ^# _%#: `%# aK+N,#+-#Y.~#s/#  ~1 #'#  :WB 0# 0#0#'8len'90#cr':0#N';0# 'Cv'D#0 'Ew#'Fw#P''Gw#0'Hw# W2&   Y Y    o . L   &&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#&rq&=st&@& &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&ڠ#sl&# < &W#8D&P0&2#&# &l #req&#rsp&#Xuri&#^ &#?&#9E&~#L<&0#<THNI#6 J~# K~#fL~# M~#b N#O#`%Qk #0R~# S~#$ S~#(#"T0#,6T0#0 U~#4 U~#8V~#<W#@X#H;Z#L[#\;]#lg_~#|o`#b#7b#c# d#Lew#f~# g~#;g~#c!h~#z h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 tq #fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~ #0#< 0#i# i#$~#Dk `%DQ #N ##6 ~# ~#A~#T~#J###,acl#0 #8s#@#H>;##Psrv#\ ~#` ~#d q$#hS# #~#[#~#0#~#~##~#1~#q# #P~# ~#*%##f~#ϱ#^$r%#id#۱# ~# ~#K~#0#u0#T0#0#  # #0#P0#< 0##"0# 0#50###5##5 ~#0# 0# 1#0#0#0#t0#0#0# 0#i# i#~#cap~##;#g~#o#Nk # G# G#Hp#qp# ~# ~# ~# o~# ~# ~# # ^# d~# )~# g%# ,%#  E# a E# [ E# y &# B  &#  ~#  # ~# `&# ~# o~# 0# v 0# -## -##H %% #%! #srv%"# _!D  ~#x <#O <#  <# #Z #  #$3# P#(& P#,& P#0 i#4  i#<! px k #sv #E w# w# L< 0# iid ~# ~#sid ~#!  #I" iid ~#px k #buf 0#sid 0# ptr ~#bol ~#s" % _! ! !"7w " " " "-# ,u\v#t0w#t1w#5xq #Nyq #z~# {{~#$|~#(#<#len0#pos0# sid0#srv#oek #src#bufa ##bek u# X0#:#!$ srv!$#G ~#6 ~#L$Xact"#bck"#,q$act#bck#`%~#~#o ~#>~# ~#~#~#J #map## W'$#, L$# l%#e4l%#5l%#l%#l%# l% `%% ~#0~#5~#7~# <~# ~#+~#~#*% %& #&l &_#(dow(~#h1(~#m1(~#h2(~ #m2(~#&(min(i#max(i##(~#"(~#&(;(ϊ#c(Њ# '(i(~(́&e"(&c#(#&J'(ptr(str(reg(J'~'S#,((Ʊ#val(&#ptr( '##(# len(~#$L<(~#(' (p(i(~ll(id('a(' 'P("0(i(~#ptr(#len(~#L<(~# ctx('#("(kw(# ((# +#(j)# b>()# (0# 4$( ~#(~  ( P'()~ k  ~ ) d) )d)>( (!#kw(")#arg(%)# #(&~# "('#'()~ d) (p))#( (#kw()#)P(!")(%#str($P($3*X"/`U%s. S&X0p'3*il(D*)N*V)X*W*d*#$.~+fd.~+sa.d*,".j*-t/8'@~ǞU%fd@~.lA }.pBk W/sC .txnDt/}/tE.cfdF~}&#G~}01#0"0#]0;#]0"=0"0$0j"1f- &;P~&#Q}1+ .__pnV2+z/͎3/4 3/1+5/}'/(/2+/z(/2,/(/2!,/ّ͑)0Q(01I,(6pn@!0~6sn@!0}1,H6lenR~P7{6pnb!0}77B8__vi>1,`6__poR2,10(>02,J0?F(W01,x6__pR2-10(>02-c0(p028-{0(0(0'04e(0'/7=)0S(09- P6pnX ~7:P8__v_>1-6__pQ9-8__s1-6__pQ9-8__s1.6__p!Q2=.01`)0P7=C309[.ș6msgl }9y.Ι6msgl }9.E.maxJ~P9.gr8__vK>1.8__vJ>1/6pn0 ~6sn0 ~9/w8__v;>4 8__v:>2//0](09I/:h2`/0(1'06U(1*/K /t;/__p*/3+tpxk >l4 R>l7>dir~?)?)?"d)Q=#2$~ sU>pxk >l4 P>l7>dir~?)?)?"d)R9 23>8__v>7S^8__v>=2w" ~U>px k >l4  S>l7 >dir ~?)? )?" d)V=53"~{U>pxk >l4 S>l7>dir~?)?)?"d)V93&8__v&>7Va8__v$>=3#0~U>px.k P>l4.  >l7.>dir.~?)?/)?"/d)P@v#FUA")3eA)3A] +oA+t3TA+u~A +v~A ,Z~14BA-Q 4A;0Cnow<<A=<A,VA,\a Cone,^A,_4 2A $EA .EA .AQ0ARR0AU0Ar VEAW5DK#7)Ot1v+Dn2N%h J0?>x  "0:5 &i@intm 60 >E ?E AE3 C| D^?G6 S^ U  0BGQ8Fe* DE#VF#  >+ p##  !p###  w 2>o40Y M n'#p## 2## 7  -@ - K< ~# - #  # # # y # M # 7 # z #  #$ g #(  #, #0  #4 . ~#8  ~#<  #@  ">#D ` #p#F  $#G ` (#H  1#L 7#T 3 8#X S :~#\  <#` b ) M # # ~#M  F  3 b#  9  M# # # bit~#u32"0mA*F+#key,9# n #p #m - m#ref !#.x D 0wq 1D#rq 2D#6 3~#0 4~#4 5D#8V 6#< 7~#@>>>.4wl x@#ym#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u#(   '8"H6 "I0# "J0#J"K#fd"L~# L<"M0#exp"N0#2"O#2"P#1"Q# 2"R#$ib"S" #(ob"S" #, "T0#0"U#4" "SL<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0 0#4~#8& #< 7#@7#AW#DH#L& #P #T #XQ P-tstru#lenv~#b b " h   z#m#L#m#x #>## #fe#_#be#_##~# L<#~#$ #0#(req#" #,rep#" #0si#g #4i ##\"##k#M#srv#### ## #w #txn#c#2 #~#f### #E/# # #w##w##= #@#0#Q  . ]W )n!  p#!W # g k auid^&#gid_#T`# buxag  LfdM~#6 N~#O~#;P#  Q #SR~##"S~#T0#NU #Vm#>'W #XD#^$Y #Z# [0#nb #'c# TQum #2n~#o~#p~#h qp# re# s~#$1t #(2u #,Kv #0w #4x #8wy #<7zm#@4{~#H|m#L   ~~ ~  ~  !Cf!A #b!B" #o !?cb!Co#J!D#6 !E7#ev!F7#W !G#!He#  {d1!h#("!i#,C!j#0u!k#4&!l~#8y~y~ ~dy~~. L#(#~#P# m#Jr a^#_%#:`%#a?+N,#+-#Y.~#s/# } r1 #'#.S&8len&90#cr&:0#N&;0# &Cv&D#0 &Ew#&Fw#P'&Gw#0&Hw# %YY  o.L   %Q%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%Q]@% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%]#sl%# < %W#8%P0%#%S# %( #req%#rsp%#Xuri%#^ %#?%#9E%~#L<%0#8B 0# 0#0#<THNI#6 J~# K~#fL~# M~#b N#O#`%Q_#0R~# S~#$ S~#(#"T0#,6T0#0 U~#4 U~#8V~#<Wm#@X>#H;ZM#L[M#\;]M#lg_~#|o`#b#7b#c# dM#Lew#f~# g~#;g~#c!h~#z h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#vr0#Vr0#gsD#4 te#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~#0#< 0#i# i#$~#8_`%DQ #N 2#2#6 ~# ~#A~#T~#JM#!#,aclm#0 m#8sm#@m#H>;"#Psrv#\ ~#` ~#d "#hS# #~#[#~#0#~#~##~#1~#q# #P~# ~#*-$##f~#m#^$ٮ##id#m# ~# ~#K~#0#u0#T0#0# ##0#P0#< 0##"0# 0#50##2#52##5 ~#0# 0# 1#0#0#0#t0#0#0# 0#i# i#~#cap~#M#;M#g~#o#N_#  #  #Hp#qp# ~# ~# ~# o~# ~# ~# # ^# d~# )~# g9$# ,9$#  9# a 9# [ 9# y ?$# B  ?$#  ~#  # ~# `O$# ~# o~# 0# v 0# i!# i!#H $$ m#$!b #srv$"# SD# #~#x#<#O #<# #<###Z##  ##$3##P#(& #P#,&#P#0#i#4 #i#<#px#_#sv##E#w##w# L<#0# iid#~##~#sid#~# ##͘#= #iid#~#px#_#buf#0#sid#0# ptr#~#bol#~#g # %#S # # w  k b }  b    p7 ;4{un5. in6M Kp2u7 #i! ,u\v#t0w#t1w#5xe#Nye#z~# {{~#$|~#(!<#len0#pos0# sid0#srv#oe_#src#buf #"be_ u*" X0#:m#]" srv]"#G ~#6 ~#"Xact #bck #,"act#bck##~#~#o ~#>~# ~#~#~#J #map*"# Wc"#, "# ##e4##5########'$ ~#0~#5~#7~# <~# ~#+~#~#*'$ 3$ O$ _$( $2 *,*-~#kw*.#*5$#$~]~__~$$*=*>m#kw*?$# $_$!<%'Q'M~#'N~#'O~# 'P~# &';uid'<~#gid'=~#'>~##"'?~# '@~# 'A~#'B~#('C~#T'D~# 'E~#$'F~#('G#,%'H#0H'I~#4q'I~#8'J~#<'J~#@ 'K #D 'K #@'Q$# 'R #a'S~#"&q$2U#cap1~R"&%B*U$TB~R%^)R$Y~0(U$d;W]$W~ $`%W_$!%X_#errX$5X~&^$Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V('8)]c%)c%*'mz)]g%)g%*(~)]g%)g%+(^),o)*A(dq)]l%)l%*e(u)]p%)p%*()]t%)t%*()]t%)t%*()]y%)y%*(")]y%)y%*))]~%)~%*=)ţ)]%)%-)]%)%.{)2/`%1_%*$~0U$d;]S$~ $`%_$!%_#err$5~&~l0cap~'resp)u'tv*W0td*'val0V(]*X)]%)%**dt)]%)%+**,*1*P,*2^),o)03*$3P414G1]4>2~"+D%_mU$u$T~ #cap~W&_S&q_p*y+ȥݥ)]%)%++^),o)2^),o)5,%pU6px,W7u 8t%S8qV-9]%9%!, 5,$3~:U72_S7(2V+u,^)@M,o)+,^)p},o)+,^),o)+,^)ҧߧ,o)2^),o)5~-$X~@۩U7$W~8Y_V8Z S8M$[~W:err[~~8>%\~~:msg]~-~+j-^)Wc,o)2^),o) - c;- U:p_S2-^d1-P1-P.-9 L~t~+.N/1_/Q,j/2v/,/,/+//Ĭ1/Q,/2/3U1/Q,/2-391-S,-.v/$~__vj>- >__vh>?$ 2U@"0@0@] !o@!t0@!u~@ 'Z~ 0A @(Q0B`%(_B>)~P@);0Cnow)<<@'V<%B7'~T@'`~8'%z$P\6/Nv@'h J0?>x  "0:5 &i@\ 5intm 60 >E ?E AE3 C| D^?G6 S^ U  0BGQ8Fp*  D E#V F# &-{ &- K<'# -' # ' # ' # '# y'# M'# 7 '# z'# '#$ g'#( '#, ']#0 'c#4 .'#8 '#< '#@ '">#D ` '#p#F '$i#G `'(y#H '1#L '7#T 3'8#X S':#\ '<#`  b']) 'M']#'c# '#&{ y   3 $ >+   # #   ! # # # % wN)n!  #!N# ^ k2>o40Y^ i n#ښ#t# ܊## 7  b# -- }  M# -# -# bit#u32"0A*F+3#key,}# n #p # - #ref !#rx D 0wq 1#rq 2#6 3#0 4#4 5#8V 6#< 7#@r'4wl x#y#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u'#( 7  '8!H6 !I0# !J0#J!K#fd!L# L<!M0#exp!N0#2!O#2!P#1!Q# 2!R#$ib!Sf #(ob!Sf #, !T0#0!U#47f !SL<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8&O #< 7#@7#AW#DH#L& #P[ #Ta #X P-tstru#lenv#  f  O  z#L#x # #fe2 #be2 ## L<#$ 0#(reqf #,repf #0si:"#4i #\"#k#srv## # J"#txnm#2 #fu #\"#E/s"# w#w#"#@0# U r ] auid^1#gid_#T`&# buxar  LfdM#6 N#O#;P#  Q #SR##"S#T0#NU #V#>'W #X#^$Y #Z# [0#nb #'c# TQum #2n#o#p#h q# r# s#$1t #(2u #,Kv #0w #4x #8wy #<7z#@4{#H|#L        (Cf(A #b(Bf #z (?cb(Cz#J(D#6 (E7#ev(F7#W (G#(H#  o1<(](^#!=(_#set(`#clr(a# =(b# =(c#rem(d#clo(e#1(f# 5(g#$8>(h#("(i#,C(j#0u(k#4&(l#8 op7;4un5%in6'Kp2u7#h)Q)M#)N#)O# )P# );uid)<#gid)=#)>##")?# )@# )A#)B#()C#T)D# )E#$)F#()G#,%)H#0H)I#4q)I#8)J#<)J#@ )K#D )K#@)Q'# )R #a)S# L#(##P# #E a^#_%#:`%#a+N,#+-#Y.#s/# P E1 #'#B 0# 0#0#]$8len$90#cr$:0#N$;0# $Cv$D#0 $Ew#$Fw#P'$Gw#0$Hw# #   Y Y    o . L   #[#l#݉#m_l#މ#u#߉#u_l#߉# v##v_l###l##v_l##c##c_l## r##r_l###rq#st#[g@# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#g#sl## < #W#8 #P0###]# #l #req##rsp##Xuri##^ ##?##9E##L<#0#<THNI#6 J# K#fL# M#b N#O#`%Q2 #0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<W#@X#H;Z#L[#\;]#lg_#|o`#b#7b#c# d#Lew#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t8 #fu#w0#w0# x0# y<#{0#{0#|0#t|0#}0#~#0#< 0#i# i#$# 2 `%DQ #N ##6 # #A#T#J#r##,acl#0 #8s#@#H>;##Psrv#\ #` #d 8$#hS# ##[##0#É#ĉ##Ɖ#1lj#qȦ# #Pʉ# ˉ#*̸%##fΉ#ϱ#^$9%#id#۱# ܉# ܉#K݉#0#u0#T0#0# ##0#P0#< 0##"0# 0#50###5##5 #0# 0# <#0#0#0#t0#0#0# 0#i# i##cap##;#g#o#N2 # # #Hp#qp# # # # o# # # # ^# d# )# g%# ,%#   # a  # [  # y %# B  %#  #  # # `%# # o# 0# v 0# "# "#Hu "" #"! #srv""# &!D #xG#O G# G##Z#  #$3#P#(& P#,&P#0i#4 i#<!px2 #svdz#Ew#w# L<0# iidʉ#ʉ#sidʉ#! #"iidЉ#px2 #buf0#sid0# ptrԉ#bolՉ#:"%&!Ν!ִ! J"7 > \" P"s" b"" ,u\v#t0w#t1w#5x8 #Ny8 #z# {{#$|#(r#G#len0#pos0# sid0#srv#oe2 #src#bufa ##be2 u# X0#:## srv##G #6 #$Xacty"#bcky"#,8$act#bck#'%##o #># ###J #map## W##, $# 3%#e43%#53%#3%#3%#3%'%% щ#0҉#5Ӊ#7ԉ# <Չ# ։#+׉#؉#*% % % %l  !&&)@U"( Q#'n&@U" ? R$A S%errB&'C'/'():'*'E'Dz+V'V+a'+l'+w'(,'_,',','P,'W-'a-'-'-'&'вڲ''.E'b'/ 0fd.'A&_/N.^1uid^11gid^/T^&2e&`'2&a'2;b%0retd2 d3%3#'3~'3& '4'` T1fdS#~(%RU" Q P$S S&~(4'(&(Zĵ+(~(,(~,(V,(P5('6 4(&/N.2;%2 щ0retщ7*3'gؼU8fdg%lh ~9si 9tj%cfdk~$#l~:1#-|:"*]:#(::4&&!;*$;t~$#u~;)%__pS*)*)*()*(H,+W*)+CJ'+;*p%__sP;**%__sP;B*%__pR*Y*)+UX'6+;q*%__pR**)+'6+**'ú''&B+NQ'S+'\+**f+:]'s+<]j=h+.+K 0t>0__p.)+31t4B+"/1buf.f .f+h1tg1fg04}+1tƂ7-&7tU8s6 "J+6Q$d;8-%arg9W?+j=]R%=R%?,=]S%=S%*A,-'-+-P'-*d,-޽'-+-P'-?,=]`%=`%?, =]f%=f%?,"7=]j%=j%* -.Ⱦ'.&!.Ⱦ'4.'@.'L.*>-.Ծ'.&!.Ծ'4.'@.'L.*r-.'.&!.'4.'@.'L.*--)+'-+-P'-&.Wc'.&!.Wc'4.'@.'L. - 4.&1s 1bf /'O @!.i6h@Y. -6+6G+g6>,7'/%U8s S8reqf V$J+W9p*.'/+8/R+C/Q*.O/ +\/P?.HV%__sW*/h/VY'u/&O/q'\/.O/qk/ j1nowj4h/#&1buff 4/T&1buff 73&U8t%s p$E'l$u'0h$L'0W:'i:&l:% ;00=L<0&3<C'3?_0Gp$L<0R&3QV'3*v03'3*03'3'3*03+3R+3V&3+3R+3V*03'3+3S*13*'3'3*513Qu'3'3B%L55 ~BI%M5B"&:5pB&:5B] (oB(tg5B(uB (vB )Z 5C B*Q5B+;0Dnow+x "0:5&i@\5intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fp* 'D'E#V'F#^27 2J2G# p r=2J{ --K -- K<.# -. # . # . # .# y.# M.# 7 .# z.# .#$ g.#( .#, .#0 .#4 ..#8 .#< .#@ .">#D ` .#p#F .$#G `.(#H .1#L .7#T 3.8#X S.:#\ .<#`7W Qnzb.) .M.#.# .#  z  3tm,w$x#y#gz#o{# 3|#G}#+~#_#v# #$Q#($>+ ##  !### & wKnK#pK#&z - &#ref!K#4&wl &xb#&y&#&z0# M &{0#%&|0#p&}0#0 &~0#L<&0# -&0#$u&#( # F bF# VV #  M+# V# V# bit#u32"0A*F+\#key,#Gx D0wq1#rq2#6 3#04#45]#8V 6#<7#@WWWG L#(##P# &#cNL#(#z2>o40Y 7 n#|ڛ## #|# 7 Z '8 H6 I0# J0#J K#fd L# L< M0#exp N0#2 Ol #2 Pl #1 Ql # 2 Rl #$ib S #(ob S #, T0#0 U#4f f Z   SL< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& #< 7#@ 7#A W#DH f #L& f #P #T #Xr  P- tstr u#len v#       z &#L &#x W# @#fe !#be !# # L< #$ 0#(req #,rep #0si ##4i #\" #k 7#srv t# t# t# $#txn #2 #f 6"# $#E/ 4$# w# w# ##@ 0#  ] )n!! ! #!! # k 3 auid^1#gid_#T`&#F buxa MLfdM#6 N#O#;P#  Q:#SR##"S#T0#NU@#V&#>'WV#X]#^$Y\#Z# [0#nb3 #'c#: TQumb#2n#o#p#h q# r# s#$1tV#(2uV#,Kv#0w#4x#8wy#<7z&#@4{#H|&#LMF VF r :r /Cf/AV#b/B # /?cb/C#J/D#6 /E7#ev/F7#W /G#/H#   Z NZ####R N## #`* %n&# '#W(#.3)# L<*#-+Z#,#N-# %N%#u%#X%#len% # %!#wA%"# p 7; 4un 5 in 67Kp 2u 7# 0Q0M#0N#0O# 0P# O0;uid0<#gid0=#0>##"0?# 0@# 0A#0B#(0C#T0D# 0E#$0F#(0G#,%0H#0H0I#4q0I#80J#<0J#@ 0K#D 0K#@0Q# 0RF #a0S#  #a#^##_%#:#`%##aO9#e #j#h#a#i#J#j "+N", #+"-#Y".#s"/Q#  G1 K#'Y#SSGB 0# 0#0#*8len*90#cr*:0#N*;0#& *Cv*D&#0 *Ew#*Fw#P'*Gw#0*Hw#  q)!!!Y!Y ! !!o!.!L !  ), )l)݉#m_l)މ#u)߉#u_l)߉# v)#v_l)# *)l)#v_l)#c)#c_l)# r)#r_l)#G)rq)|st)@) )0#sol)#eol)#som)0# col)0#sov)0#eoh)0#cap)#sl)*# < )W#8)P0)q#)# ) #req)G#rsp)G#Xuri)#^ )#?)#9E)#L<)0#+) J+)Q#idx)#val)# n)# t<THNIt#6 J# K#fL# M#b N#O#`%Q!#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<W&#@XW#H;Z7#L[7#\;]7#lg_#|o`#bt#7bt#c# d7#Lew#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t!#fut#w0#w0# x0# y<#{0#{0#|0#t|0#}0#~_#0#< 0#i# i#$#!`%DQ@#N ##6 # #A#T#J7#3%#,acl&#0 &#8s&#@&#H>;Q%#Psrvt#\ #` #d %#hS# ##[##0#É#ĉ##Ɖ#1lj#q# #Pʉ# ˉ#*##fΉ#&#^$&#id#&# ܉# ܉#K݉#0#u0#T0#0# _#_#0#P0#< 0##"0# 0#50###5##5 #0# 0# <#0#0#0#t0#0#0# 0#i# i##cap#7#;7#g#o#N!# # #Hp#qp# # # # o# # #  # ^ # d# )# g# ,#  # a # [ # y s'# B  s'#  #  # # `'# # o# 0# v 0# $# $#Hz+6" (( &#(! #srv("t# "D  #x G#O G#  G# #Z #  #$3# P#(& P#,& P#0 i#4  i#< ^# px !#sv t#E w# w# L< 0# iid ʉ# ʉ#sid ʉ# u#  Q# # iid Љ#px !#buf 0#sid 0# ptr ԉ#bol Չ## % " ^# u# $ !$ $4$ f #$$ ,u\v+#t0w+#t1w+#5x!#Ny!#z# {{#$|#(3%G#len0#pos0# sid0#srvt#oe!#src#buf #Q%be!u v% X0#:&# % srv%#G #6 #t %Xact:$#bck:$#, %act+#bck+# &##o #># ###J t#mapv%# W%#, %# &#e4&#5&#&#&#&t& s' щ#0҉#5Ӊ#7ԉ# <Չ# ։#+׉#؉# ' ' "'#4!#u' &# @H(#be'# H(A? +?&# "+@&#pol+A# +B0# J++C#'(?(! "&# @#H(# $# %# %&# '# L<(0# )# *#$A)_#+dow+#h1+#m1+#h2+ #m2+# )+min+i#max+i##+ˉ#"+̉# )+;+#c+#)+i+ȉ+A)e"+ш)c#+( *+ptr+str+reg+ *q*S#,++&#val+ӭ)#ptr+)##+h# len+ډ#$L<+ۉ#(* +p+i+ll+id+*a+*  * +"0+i+#ptr+#len+#L<+# ctx+q*#w+"+kw+Q# ++# +#+*,# b>+E,# +0# 4$+ #+\+\*w++! +$,+$,>+ +!&#kw+",#arg+%,# #+&# "+'&#*+E,$,+0,v,#+ +&#kw+v,# ,+$",+%%str+$+,( P0q#len # Y  ,# ,W  ,&[--9U'iԉQ'tmpQ'msg։S(E-6K)__s*K_)__s+-0@U,b} ,msg}-W-~-p-Y ~QS./=P/lenG+F.)#U,b R,msg-S--V-Y Q,lenW./=P+.00U,hdrQ,endQV-uQ,lenW0valQR+.+QU,sQP,eQS.l*V.*Q+/5- U-uQ,len ,solQW,idx-R,ctx/0eolQV0sovQS.{-p1=0  1*s2//3/4/305/-<6;-50.160-+g0q,U-uQS,solQ ,idx-,ctx/71'#U,t! S,si!f R,err"-'" -9E"W,msg"1V20 18-1Q21 1'^3-1491^c3F11 991S.~:buf} 9R1#:buf +1161U,s5 S-05Q ;1/DqqU,strCQp,lenCl0mE7P0hF1S1 ,;22(]CU,txn\22P0ptr^Q0end^S<2.PU,s W,sif  0txn22V0rdr h.N.Q0lenS42~322228 3Q334)336392E,(:s't9#3#0:ctr/#3:inc/0_9B3#!:ctr #3<39/U,s V,sif S. P<5r+U,s V0pn0fe!~0be!~=|!0txn22W.~0uriP0hR.t~0tm~.)5 .;~0hdrS245h85~8+5P24B53S53^524u5>z3535*>z>5(4/__vG>*/__vF> 5?75@now75@tm<5 <5j53(:tv1j5:tv2j5p5 GA5JP@tv1Ij5@tv2Ij5/retKP<6h/gsU,some,idxe- ,capf- f0eolhp0solhl0colhV0sovhW.{-ih0hjS0lenkd2{6/3/26/30B0__pQ+7+QU,msg-V-i,QW-6 0S,ptrQR,endQQ-,- )7 1:*91 ( 1/i101-1g-1s*1O(0+8V,*QU,msg'-S-i,'Q -6 (0P,ptr(QR,end(QQ-,)W- ))7 1*/1 (C1,E1)N1j1[1,f1`.og1t.P1/]1*h>:9:=(F6E-:lenE:crE9:#"6!-C)e$+;*U,t -4!P0txn22d.*`.Z\='-.{-V0hSDH; 0__sW2_;/[x3/Du;P/len2;;RU3<2; <UX8<Q2;%<il32<2;><3K<3T<3]<Bh0msg h9 <T&:bufû 9%<%:buf 9><#&:buf 9i<&:s :b 6' +<}05 U,s4 S,req4 V0txn6 22W2<<-8=P8=R4u57O3535BE5P5=qk6 j:nowj+_>/_ U,s^ ,req^  0msg` -W.)a PT.%b i@0ctxc X1+ (=x.P-p 0PB/cr B0hext 0R*.t P2>< 3=8=P2(>;$3<4_>*F8p>R8{>P4>@D8>P3>5>!W:nowV6^$V5>9 L:nowK6^$K<~?+&U,t P,rtr Q0txn22p0p1l0p2V.-V. +S.,h.{-W2[?/3/B.,&P0valP s.- S. + V., l={- .( h.w) d0txn 22`., &W0len P. P4/3/+A6+4 PTU,t3 ,req3  ,exp3 W.8>5 s.-6 l. +6 V..(7 h0txn8 22S0len9 P.9 P4T:3a:8l:P8w:R+&B. `U,t W,req  ,exp S0txn 22VB0ret P<D0 jU,t  ,rtr   0txn 22D0p1 @0p2 S0p3 0p4 .*SS.U*H.-. +V.,.{-.(.S22C/43/DZC .,&0valRDC8.,%VDCh0__pQDC0__pQ4_>8p>R8{>P4>8>P3>DD.([VB0__p]QB0__pQ<7E%03pJU,t2 -+2Q ,len20txn422D.*5SW.U*6H.-7VDD0__pLQ2D_>8p>R8{>P4>8>P3>D"E0srvvtS*=]x%=x%B(0__pZQ8p>R8{>P4>8>P3>DG. SDG0srvO t.t(P DG0__p QB . P+H((U,t' P,rtr'  ,exp' .8>)s.-*V. +*S.,*l={-+.(+h.w)+d0txn,22`.,-&W0len.P..P4/3/+I,,U,t ,rtr  ,exp .8>s.-W. +V..(l0txn22S0lenP.P4T:GJ3a:8l:P8w:R+J.$ U,t W,rtr  ,exp S0txn22VB80retP 3/2KMN l 3M3M4u5l  3535*l  E5P2;L <3<2RL%<32<(nL0len S(L0eol V0sol W2L/.93/4/OV302L <3<2L%<32<2M <3<2M%<32<(qMT0es MV./ Q2]M <3<4%<32<2M%<32<2M <3<4;v3<9M**:buf 60 $+T. .U,s ,req  .{-W0txn220msg-.1!~1. k1)( 1)UDN.@H(W.TW=-!DNP0retRB0rdr .o)QRDN0retP2.O T3T428 3R33DO .-S. +W.,~.{-~.(~.P0valP.,&~4/GJ3/D P@.!TWDOX0retR4 TLz3T42RX8 3R332QP T3T428 3R332mPMUq3M3M2P 18-1R2P;3<2P_>8p>Q8{>P2P>8>P3>DQx.N.7QV.d*8S22Q T! "3T42!!8 3R33DIQ0qs?PDQ0lenPVB.i0ctx4;F#I#3<DQ0lenaV0pnbKWDQ 0len|S0pn}'TDR@.@H(VB`0retPDYRx.P. +S4T:&0&3a:8l:P8w:RDqR0__pQ(R\&&.U/S(RZ'(0eolS0solV2R/}''3/4/''302R<((3=8=P2S;()3<2PS_>)7)8p>R8{>P4>-)5)8>P3>2gS)3L)i)363(Su)+*0es MV./ Q2S)3d**3632S)3**363DS0ctx2S)3,,3634;--3<N(9!T<$ L:be K!' 7T -;TF0..l.U-Y -\S-"A-+W---\/len/.P0/P;#U0Ap..U,px?!,l4?  ,l7?R,dir?-)?@+-"@$,Q.P0BP/txnC22;gU*/Y.//U-"X$,Q-"AX+S=O/Z;UY+q0/q/U-Y p\S-"Ap+V--p\;GV,|//U,pxz!,l4z  ,l7zP,dirz-)?{+-"{$,V/txn}220ptr~R0lenQ;V*//0U,px!,l4  ,l7P,dir-)?+-"$,V/txn220ptrR0lenQ;W')000U,px!,l4  ,l7R,dir-)?+-"$,V/txn22/ptr0lenP4Wa008WQ8WS*f00EWR5WJ0:sQ:lenۉ)i0;PX(+00U,px!,l4  ,l7R,dir-)?+-"$,Q/txn22;XV-0S1U,px!P,l4 V,l7R,dir-)?+-"$,S/txn22;\Y0`11U,px!P,l4 S,l7R,dir-)?+-"$,V/txn22*11/__v>;Y1"12U,px !P,l4  R,l7 P,sol  -)?!+W-"!$,S/txn#220idx$-Q0ctx%/V;lZ8)>22U,px<!V,l4< S,l7<Q,dir<-)?=+R-"=$,P/txn?22;Z(Q23U,pxO!V,l4O S,l7OQ,dirO-)?P+R-"P$,P/txnR22;[.c 33U,pxa!P,l4a R,l7aP,sola -)?b+W-"b$,/txnd220idxe-V0ctxfX0cntgS;\,y33U,pxw!V,l4w S,l7wQ,dirw-)?x+R-"x$,P/txnz22;\-34U,px!V,l4 S,l7Q,dir-)?+R-"$,P/txn22;]*44U,px!P,l4 R,l7P,sol -)?+W-"$,V/txn220idx-Q0ctx/S;](145U,px!V,l4 S,l7Q,dir-)?+R-"$,P/txn22; ^*5O5U,px!V,l4 S,l7Q,dir-)?+R-"$,P/txn22;^D.P55U,px!,l4  ,l7P,dir-)?+-"$,S/txn220ptrP0endVFZ)R55UG,,K^^ >G,L^^ ~GI,M^G"-_G-_GGG/t:_G/uG 0Z k_H GQZ_G;0Inowx "7:5&p@m67>L?LAL3C|De?G6S^ U 7~-BGQ8Fp* !D!E#V!F# %-{ %- K<&%# -& # & # & # &# y&# M&# 7 &# z&# &#$ g&#( &#, &]#0 &c#4 .&%#8 &%#< &#@ &"E#D ` &#w#F &$i#G `&(y#H &1#L &7#T 3&8#X S&:%#\ &<#`  b&]) &M&]#&c# &%#&{ y   3% %$E+ ##   !## # 0 w{Wڥ#ۺ# ##)nW!  #! #2Eo47Y  n# >    b # .. ~   M #  .#  .# bit %#u32 "7A *F +4#key ,~# n #p # - #ref !#sx D 0wq 1#rq 2#6 3%#0 4%#4 5#8V 6#< 7%#@s(4 wl x# y# z7# M {7#% |7#p }7#0 ~7#L< 7# - 7#$u (#( 8  '8H6 I7# J7#JK#fdL%# L<M7#expN7#2O#2P#1Q# 2R#$ibSg #(obSg #, T7#0U#48g SL<}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#, 7#0 7#4%#8&P #< >#@>#A^#DH#L& #P #T #X P-tstru#lenv%#  g  P  z #L #x # #fe R#be R# %# L< %#$ 7#(req g #,rep g #0si j$#4i #\" #k 6#srv (# (# (# z$#txn t#2 %#f "# $#E/ $# ~# ~# @$#@ 7#  $ %#H$!%#& $"%#N$# # V ] k auid^1#gid_#T`&# buxa  LfdM%#6 N%#O%#;P#  Q #SR%##"S%#T7#NU#V#>'W#X#^$Y#Z# [7#nb #'c# TQum#2n%#o%#p%#h q# r# s%#$1t#(2u#,Kv>#0w>#4x>#8wy>#<7z#@4{%#H|#L  %% . >% .e'Cf'A#b'Bg # '?cb'C#J'D#6 'E>#ev'F>#W 'G0#'H# D 1<']'^#!='_#set'`#clr'a# ='b# ='c#rem'd#clo'e#1'f# 5'g #$8>'h#("'i #,C'j #0u'k#4&'l%#8%%% %d#8len#97#cr#:7#N#;7# #Cv#D#0 #E~##F~#P'#G~#0#H~# %"YY  o.L   "b"l"%#m_l"%#u"%#u_l"%# v"%#v_l"%#"l"%#v_l"%#c"%#c_l"%# r"%#r_l"%#"rq" st"bn@" "7#sol"#eol"#som"7# col"7#sov"7#eoh"7#cap"n#sl"# < "^#8"P0"#"d# "m #req"#rsp"#Xuri"#^ "#?"#9E"%#L<"7#e L#(#%#W# # a^#_,#:`,#av+N,#+-#Y.%#s/#  31 #'E#??e3 X`%D#N ##6 %# %#A%#T%#J6#- #,acl#0 #8s#@#H>;K #Psrv(#\ %#` %#d  #hS# #%#[#%#7#%#%##%#1%#q # #P%# %#*s"##f%#ϲ#^$!#id#۲# %# %#K%#7#u7#T7#7# ##7#P7#< 7##"7# 7#57###5##5 %#7# 7# <#7#7#7#t7#7#7# 7#p# p#%#cap%#6#;6#g%#o#NR# 0# 0#Hw#qw# %# %# %# o%# %# %# # ^# d%# )%# g"# ,"#  p# a p# [ p# y "# B  "#  %#  # %# `"# %# o%# 7# v 7# # #HB 7# 7#7#0p7;4un5{in66IKp2u7#  #! #srv"(# (<T"NI(#6 J%# K%#fL%# M%#b N#O#`%QR#0R%# S%#$ S%#(#"T7#,6T7#0 U%#4 U%#8V%#<W#@X#H;Z6#L[6#\;]6#lg_%#|o`#b(#7b(#c# d6#Le~#f%# g%#;g%#c!h%#z h%#h%#i%#j%#Fk%#idm#n7# n7#o7# p7#q7#vr7#Vr7#gs#4 t.#fu(#w7#w7# x7# y<#{7#{7#|7#t|7#}7#~#7#< 7#p# p#$%# ,u\v#t0w#t1w#5x.#Ny.#z%# {{%#$|%#(- G#len7#pos7# sid7#srv(#oeR#src#buf #K beRup X7#:# srv #G %#6 %#( Xact4#bck4#, act#bck#!%#%#o %#>%# %#%#%#J (#mapp # W #,  # !#e4!#5!#!#!#!(!m" %#0%#5%#7%# <%# %#+%#%# *m" y" " "m V#D  %#x G#O G#  G# #Z #  #$3# W#(& W#,& W#0 p#4  p#<# px R#sv (#E ~# ~# L< 7# iid %# %#sid %##  #@$ iid %#px R#buf 7#sid 7# ptr %#bol %#j$ % V# # # z$8 I$ $$ $$+Q+M%#+N%#+O%# +P%# 0&+;uid+<%#gid+=%#+>%##"+?%# +@%# +A%#+B%#(+C%#T+D%# +E%#$+F%#(+G#,%+H#0H+I%#4q+I%#8+J%#<+J%#@ +K0#D +K0#@+Q$# +R #a+S%#!&22L%5#6U"2L%S"92L&Q"2L%R"2L&V#lenL,W"L<LWP$LS%'2%06|8U&sip&bg S'2%l'%h(ret%Q(max%d)D'2)88U&si(S!(1%9?U#fd%*sip*bg S*ret%Q*max%W$%l$2%h$1%d+!C9+#2=+j k9,('j2%V-"((:':.(V/(-c((:';/(/(01(V1)Q2)2)1))V3(;;(fwd<%R45)1=J=.F)R.Q)P4])@=H=.n)P/y)5(h6tg6fg755)s2h%6bgg 6sig7fdi%7retj%7maxj%8j%8k%5])!W%6nowV%9^$V%5)9 L%6nowK%9^$K%))2?J@U&siS:*2|%P@CU&fd{%(si}W(b~g V'%p+!@+2@A+j iA-?*(@@.(S/(-V**iAlA/*-*5)sAA.F)S.Q)P4])AA.n)P/y)-*(AA.(S/(45)B,B.F)R.Q)P4])&B*B.n)P/y)5+1D%9C%)+R2CCDU&siBV(ibDg W(obEg S(fdF%p-+5)CC.F)Q.Q)P4])CC.n)P/y)45)D0D.F)R.Q)P4])*D.D.n)P/y))+1DDU&siR(ibg P),2E GU&siV(obg S'%P+j E-V,*EE/*-,5)EE.F)W.Q)P4])EE.n)P/y)-,(EF.(S/(45)FF.F)R.Q)P4])FF.n)P/y);"%,p;%,;] 'o;'t-e;'u% C-< ;(Q2-;);7;*%;Q7;RR7;U7;r Vp;W-;+V$*98KG2h J0?>x  "0:5 &i@intm 60 >E ?E AE3 C| D^?G6 S^ U  0 - -K<~#- # #  #  #y#M#7 #z# #$g#(#, #0#4.~#8~#<#@">#D` #p#F$ #G`(#H1#L 7#T38#XS:~#\<#`  b)  M# # ~#   / 38Fc* D E# VF#BGQ n #p #  - #ref !#x4w l x# y# z0# M {0# %|0# p}0# 0 ~0# L<0# -0#$ ux#(   b#    M### bit~#u32"0?A* F+#key, #x D0wq1#rq2# 6 3~#0 4~#4 5#8 V 6#< 7~#@?  L# (# ~# P# #ON LO# (O#~ 1 # '#~2>o40Y   n# $ >+   # # , c ! #  #  c# s w # ۬#  # # 7  '8 H 6 I0# J0# J K#fd L~# L< M0#exp N0# 2 O# 2 P# 1 Q# 2 R#$ib S #(ob S #, T0#0  U#4  S L<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 ~#8 & #< 7#@ 7#A W#D H#L & #P  #T  #X& P-tstru#lenv~#7 7  =   z !# L!# x !# !|#fe!#be!# !~# L<!~#$  !0#(req! #,rep! #0si! !#4 i !,# \"!,# k!s#srv!# !# !# !!#txn!# 2 !~# f!D# !+!# E/!B!# !w# !w# ! # @!0#&   ], )n !  # !, # < ko auid ^y#gid _c# T `n# bux a<   Lfd M~# 6 N~#  O~# ; P,# Qv# S R~# #" S~#  T0# N U|#  V# >' W#  X# ^$ Y#  Z#  [0# n bo # ' c#v T Q u m# 2 n~#  o~#  p~# h q# r#  s~#$ 1 t#( 2 u#, K v#0  w#4  x#8 w y#< 7 z#@ 4 {~#H  |#L  ~~~  ~vCfA#bB #D ?cbCD# JD# 6 E7#evF7# W GT# H# T p7;4un5 in6sKp2u7Z#'Q 'M~# 'N~# 'O~# 'P~# "';uid'<~#gid'=~# '>~# #"'?~# '@~# 'A~# 'B~# ('C~# T'D~# 'E~#$ 'F~#( 'G#, %'H#0 H'I~#4 q'I~#8 'J~#< 'J~#@  'K#D  'K# @'Q# 'R # a'S~#U a ^# _%# :`%#a"+ N,# +-# Y.~# s/# ` U$8len$90#cr$:0#N$;0#F $Cv$DF# 0 $Ew# $Fw# P'$Gw# 0$Hw#  #!!!Y!Y ! !!o!.!L !  #L#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~#J#l#~#v_l#~#c#~#c_l#~# r#~#r_l#~#g#rq#st#@# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap##sl#J# < #W#8# P0## ## # #req#g#rsp#g#Xuri## ^ ## ?## 9E#~# L<#0#B  0# 0# 0#<TH NI# 6 J~# K~# fL~# M~# b N# O# `%Q# 0R~# S~#$ S~#( #"T0#, 6T0#0 U~#4 U~#8 V~#< W#@ X#H ;Zs#L [s#\ ;]s#l g_~#| o`# b# 7b# c#  ds# Lew# f~# g~# ;g~# c!h~# z h~# h~# i~# j~# Fk~#idm# n0# n0# o0# p0# q0# vr0# Vr0# gs# 4 t# fu# w0# w0# x0# y/# {0# {0# |0# t|0# }0# ~# 0# < 0# i# i# $~#`%DQ |# N # # 6 ~# ~# A~# T~# Js# H"#,acl#0 #8 s#@ #H >;f"#Psrv#\  ~#` ~#d  ##h S# # ~# [# ~# 0# ~# ~# # ~# 1~# qU# # P~# ~# *̎$# # f~# ϋ# ^$$#id# ۋ# ~# ~# K~# 0# u0# T0# 0# # # 0# P0# < 0# #"0# 0# 50# ## 5# # 5 ~# 0# 0# /# 0# 0# 0# t0# 0# 0# 0# i# i# ~#cap~# s# ;s# g~# o# N#  #  # Hp# qp#~#~# ~#o~#~#~# #^#d~#)~#g$#,$# O#a O#[ O#y $#B  $# ~# #~#`$#~#o~#0#v 0# !#!#HD " " # "!7 #srv""# D! !~# x!:# O !:# !:# !# Z!# !#$ 3#!P#( & !P#, &!P#0 !i#4 !i#<l !px!#sv!ǂ# E!w# !w# L<!0# iid!~# !~#sid!~# ! !Ͷ# !iid!~#px!#buf!0#sid!0# ptr!~#bol!~# !!%!!l !փ !  +!7 !B!7 1! ! ,u \v#t0w#t1w# 5x# Ny# z~# {{~#$ |~#(H" :#len0#pos0# sid0#srv#oe#src,#buf #f"beu"  X0# :#" srv"# G ~# 6 ~#"XactO!#bckO!#,#act#bck## ~# ~# o ~# >~# ~# ~# ~# J #map"# W"#, "#  $# e4 $# 5 $#  $#  $# $#$  ~# 0~# 5~# 7~# <~# ~# +~# ~#*$ $ $ $ "d%3W~GGU#63X~$$2%d%"GhG%u%&%u%'%(%R)%FGMG*%$P%%uGzG+%P*%)%GG*%,%K -t.-__p,%3/t,%9 L~/nowK~0^$K~1%0x м"[&_3#~G IU#63$~(2Y3%~3s&S3p'W4/HH#3/~V#O3/~p")'#3gIZJU5tf3php#B3i)'l#G3jS#.'jW3ik~h$&/'pII+@'P*K'$&%II+%P*%6'IJ-lent~&02h}U,W'qk~0 j~/nowj~"'OA~`JJU7o3P7t3P23234fJzJ2]%2%8''JJU73S8(3JKU3pS$((KiK*($]((K5K*()(!K5K*())!K-K* )))5KiK*0)):)x "0:5&i@\5intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fp* !D!E#V!F# (-{ (- K<)# -) # ) # ) # )# y)# M)# 7 )# z)# )#$ g)#( )#, )#0 )#4 .)#8 )#< )#@ )">#D ` )#p#F )$#G `)(#H )1#L )7#T 3)8#X S):#\ )<#` 7 6 B  b)) )M)#)# )#I{B3$>+ ## 8!##8#Hwt6 7# 8#2>o40Yt  n#ڽ#ۊ# ܠ##73 b3#CC  M# C# C# bit#u32"0A*F+I#key,#n#p# - #ref!#x D0wq1#rq2#6 3#04#45#8V 6#<7#@ =4wl x*#y#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u=#(M  '8#H6 #I0# #J0#J#K#fd#L# L<#M0#exp#N0#2#O-#2#P-#1#Q-# 2#R-#$ib#S| #(ob#S| #, #T0#0#U#4 ' 'M| #SL< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& e #< 7#@ 7#A W#DH '#L& '#P q #T w #X3 P- tstr u#len v#  |  e   z"#L"#x "#"#fe" #be" #"# L<"#$ "0#(req"| #,rep"| #0si""#4i "#\""#k"#srv"K#"K# "K# ""#txn"#2 "#f" !#""#E/" ## "w#"w#"ר"#@"0# k  ] )n!  #! # k auid ^1#gid _#T `&# bux a   Lfd M#6 N# O#; P#  Q #S R##" S# T0#N U# V#>' W# X#^$ Y# Z# [0#n b #' c# T Qu m##2 n# o# p#h q# r#  s#$1 t#(2 u#,K vC#0 wC#4 xC#8w yC#<7 z#@4 {#H |#L   3C 3j+Cf+A#b+B| # +?cb+C#J+D#6 +E7#ev+F7#W +G#+H#I1<+]+^#!=+_#set+`#clr+a# =+b# =+c#rem+d#clo+e#1+f# 5+g#$8>+h/#("+i#,C+j#0u+k#4&+l#8          / #]p7;4un5 in6vKp2u75#.Q.M#.N#.O# .P# .;uid.<#gid.=#.>##".?# .@# .A#.B#(.C#T.D# .E#$.F#(.G#,%.H#0H.I#4q.I#8.J#<.J#@ .K]#D .K]#@.Qv# .R #a.S#P L#(##P# # a^#_%#:`%#aa+N,#+-#Y.#s/#  1 #'0# * *PmB 0# 0#0#&8len&90#cr&:0#N&;0# &Cv&D#0 &Ew#&Fw#P'&Gw#0&Hw# mH%   Y Y    o . L   %%l%݉#m_l%މ#u%߉#u_l%߉# v%#v_l%#%l%#v_l%#c%#c_l%# r%#r_l%#%rq%Sst%@% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%ڶ#sl%# < %W#8Z%P0%H#%# % #req%#rsp%#Xuri%#^ %#?%#9E%#L<%0#+% J+%#idx%#val%# n%# K<T HN IK#6 J# K#f L#  M#b N# O#`% Q #0 R#  S#$ S#(#" T0#,6 T0#0  U#4 U#8 V#< W#@ X#H; Z#L [#\; ]#lg _#|o `# bK#7 bK# c# d#L ew# f# g#; g#c! h#z h# h# i# j#F k#id m# n0# n0# o0# p0# q0#v r0#V r0#g s#4 t #f uK# w0# w0# x0# y<# {0# {0# |0#t |0# }0# ~6# 0#< 0# i#  i#$ # `%D Q #N # #6 #  #A #T #J # $#,acl #0  #8s #@ #H>; ($#Psrv K#\ #` #d $#hS # # #[ # # 0# É# ĉ# # Ɖ#1 lj#q # #P ʉ#  ˉ#* P&# #f Ή# #^$ %#id # #  ܉# ܉#K ݉# 0#u 0#T 0# 0# 6# 6# 0#P 0#< 0##" 0# 0#5 0## #5 # #5 # 0# 0# <# 0# 0# 0#t 0# 0# 0# 0# i#  i# #cap # #; #g #o #N # ]# ]#H p#q p#  #  # # o #  #  # # ^ # d # ) # g \&# , \&#  [# a [# [ [# y b&# B b&#  #  #  # ` r&#  # o #  0# v 0#  ##  ##HQ ! $$ #$! #srv$"K# !D" "#x"G#O "G# "G#"#Z"#  "#$3#"P#(& "P#,&"P#0"i#4 "i#<5""px" #sv"K#E"w#"w# L<"0# iid"ʉ#"ʉ#sid"ʉ#L" ""#""iid"Љ#px" #buf"0#sid"0# ptr"ԉ#bol"Չ#""%"˾!"5""L""M " " # '"# , u\ v#t0 w#t1 w#5 x #N y # z# { {#$ |#( $  G#len 0#pos 0# sid 0#srv K#oe #src #buf w #($ be u M$ X 0#: #$ srv $#G #6 #K$X act ##bck ##,$ act #bck #%  # #o #> #  # # #J K#map M$# W $#, $# %#e4 %#5 %# %# %# % K%J&  щ#0 ҉#5 Ӊ#7 ԉ# < Չ# ։#+ ׉# ؉#*J& V&r& & &_#'dow'#h1'#m1'#h2' #m2'#'''min'i#max'i##'ˉ#"'̉#L'';'Ϡ#c'Р#''i'ȉ'&e"'''c#'҂&''ptr'str'reg'ש'(S#,''#val'L'#ptr''##'0# len'ډ#$L<'ۉ#(G( 'p'i'll'id'G(a'N( ^(("0'i'#ptr'#len'#L<'# ctx'(#)"'kw'# '6)# +#')# b>')# '0# 4$' #0) $ 0) ')e)  e) )k))>' '!#kw'":*#arg'%$*# #'&# "''#^(<)) ) 0))*#' '#kw'*#$*(!":*'%#str'$($*%8KLU%px &op&totW'V&curKQ'5Kl(*H&maxȉh)h*v͉++x8LL\MU%pxK Q&srvMKR,+MM-&+-1+.=+R4:/6 9/79+`+7h`MMU%pxg R++4zM"NU%srvyKS&p{ V0f6M,+MM-&+-1++,50NNU%srvKS&p V0f6WN,+INWN-&+-1+$,3NOU%p W&srvKV'78S&actp&bckl1NO&w`1OO2t3-J6*OQU4srv)KS5p+ W5grp,-P6f6WP64TP7,+OO-&+-1+7-+OP-&+-1+(.-8! DKR7J-+mPP-&+-1+7v--PQ--,-PQ9-P,-QQ--#:-7;;s:K<-]/l\-:-*6;sK3l.s5D QQU4sCKV5pE R5grpF-W7:.+AQPQ-&+-1+7Q.-PQZQ--,l.QQ9z.S-.:.5=  ;sK>/:4 QSU4p  V5srvKS?77.+8SMS-&+-1+,l.MSS9z.W-.3/5S8TU4sKQ2p 5grp-R7e//SS-/)@/P7|//ST-/,/T$T-/)@/P:/4z;syK2grp{-:/(4j;siK:0N7p;soK2grpq-304d@TbUU4srvcKS5pe V5grpf-W6f6gT64CU7s0+cTgT-&+-1+70+TT-&+-1+)8! KP316pUWU4srvKW?@6?35p p5grp-l71+UU-&+-1+751+UU-&+-1+7a1-{VV--,-{VV9-PA1@WW805Q?371-WW--,-WW9-P71-WW--,-WW9-V,l.WW9z.S-.3_2:5]XcXU4s\KV7K2_2 X1X-m2,- X1X9-S,x21X\X-2:x26J;sIK:26S;sRK335kpXWYU4srvjKS5pl V6f6X64X72+XX-&+-1+73+XX-&+-1+(*38! KR7F3+ YY-&+-1+7r3_26YHY-m2,-6YHY9-P,3HYWY-3:36D;sCK3L4`4`Y{ZU4srvKS5p V6f6Y64\Z74+YY-&+-1+7 4+YY-&+-1+(848! KP,x2)Z\Z-23 547ZF\U4srvKS?@6?35p p74+ZZ-&+-1+74+ZZ-&+-1+74x2[[-2,_2&\F\-m2,-&\F\-->z57P\i]U4p V5srvKS?77f5+]]-&+-1+,x2]"]-2B54fKp]^U4pxe 4urieVCne8gPp5phS8#6il8w6jhB76K^caU4s P8PT5txn7W5req| V5msg7S5px P8w60L8)PR5lenPH8#6D5ctxZX5pS)8P-0W1``2c)(5hex0R1``8PB\;8paiU4s 8`7Kp5errV6hbDoutb77\;bYb-m;9v;P(7@5len8W77;c#d-;9;V-;(7`@;Q@;P1ddE;78;3dd-;9<W(<8@<P@<\@'<V78@<Nd_d-Q<,]<Nd_d-o<,<Nd_d9<P-<)@4<S,<}dd-<,<}dd-<1}dd@<P,<dd9<P-<7v:<df-=9=l(69@=W@'=h@3=d@?=V@K=`FW=g79`=#eTe-r=)@~=Q@=R,@<#e7e-Q<,]<#e7e-o<,<#e7e9<P-<79=eeqe-=)@=PA1:eeE=7:@<ee9Q<P,]<ee-o<,<ee9<P-<,/ee-/7M:=ef-=-=,-f-f--,-f-f9-P7:=f~g->9 >W9>V)@ >X@+>R@4>T7:@<gg-Q<,]<gg-o<,<gg9<P-<7A;@>Vh i9Q>W9[>P)0@f>S@q>L@|>V@>H,l.iLi9z.S-..;5FGsF;GpF;; ; Q.;j7zKGpxx /;yGleny*h{0*l{0H*__v0I@<64K;p3 =73K2srv5K?65K?F6-H2sIK.]<7-/ 6 I|<6|<= 5 II<|<=I(C=GB0.<IC-/lB-I<^T|<=FS|<2tUCI`=7K;p =7K2srvK?kK?6K2grp-?7J3"I= 5K;grp-?F-2sKH?4-:=8;grp-?/7 :=7;grp-;sK.@>N5KGpx Guri/nKP*cK4.>45KGpx4 /74KK76K46*srv7KK67KBL?R8ikU4s SA?j4j2__v>A>j#j2__v>1#j.j2__v>1jj2__v>A4?jj2__v>1jj2__v>B?5 klU4s V5p"P5errSB@3il3sU4sh W2fdj5errjP(@H8!@p5retS8L<S(:@x8!@l5retS8L<S(R@5msgS7i@@'o,o-@7@@oo9@Q9@P,@oo9@P-A<@` TGfdS.@!WGnowV/^$V.A9 LGnowK/^$KBAx7A@sjuU4t@ S8'5BP6h5Xs7AA-t[t-B, B3t9t9BR-"B7A\;vtxt-m;-v;7A@tt9@R9@P7A@tt9@P-A,4B1uMu-AB< BE,(Gs'K<.B# 0Gctr /.BGinc /06 ,M Fh8xtyU4px S4l4  4l74dirC)?e)VC")W1y&y?]%?%MF3yAzU4px S4l4  4l74dirC)?e)WC")V8&7KR1yy?]%?%Mx "0:5&i@intm60>E?EAE3C|D^?G6S^ U 0BGQ8Fe*  D E#V F# #-p #- K<$~# -$ # $ # $ # $# y$# M$# 7 $# z$# $#$ g$#( $#, $R#0 $X#4 .$~#8 $~#< $#@ $">#D ` $#p#F $$^#G `$(n#H $1#L $7#T 3$8#X S$:~#\ $<t#`   b$R) $M$R#$X# $~#p n   3 $ >+   # #    ! # # #  w2>o40Y %a n;#ڏ#0# F## 7    b #  9   M #  #  # bit ~#u32 "0mA *F +#key ,9#n#p#m - m#ref!#.x D0wq1D#rq2D#6 3~#04~#45D#8V 6#<7~#@>>>.4wl x#ym#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$u#(   '8H6 I0# J0#JK#fdL~# L<M0#expN0#2O#2P#1Q# 2R#$ibS" #(obS" #, T0#0U#4" SL<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0 0#4~#8& #< 7#@7#AW#DH#L& #P #T #XQ P-tstru#lenv~#b b " h   zm#Lm#x ># #fe#be#~# L<~#$ 0#(req" #,rep" #0si"#4i #\"#ka#srv## # "#txn#2 ~#f!#"#E/## w#w#נ"#@0#Q  . ]W )n!  #!W # g k auid ^&#gid _#T `# bux ag   Lfd M~#6 N~# O~#; P#  Q #S R~##" S~# T0#N U # Vm#>' W # XD#^$ Y # Z# [0#n b #' c# T Qu m #2 n~# o~# p~#h q# r#  s~#$1 t #(2 u #,K v #0 w #4 x #8w y #<7 zm#@4 {~#H |m#L   ~~ ~  ~  %Cf%A #b%B" #o %?cb%Co#J%D#6 %E7#ev%F7#W %G#%H#  "8len"90#cr":0#N";0# "Cv"D#0 "Ew#"Fw#P'"Gw#0"Hw# `!YY  o.L   !!l!~#m_l!~#u!~#u_l!~# v!~#v_l!~#!l!~#v_l!~#c!~#c_l!~# r!~#r_l!~#6!rq!kst!@! !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!#sl!# < !W#8r!P0!`#!# !( #req!6#rsp!6#Xuri!#^ !#?!#9E!~#L<!0# L#(#~#P# m#rJ  a^#_%#:`%#aY+N,Y#+-_#Y.~#s/# e 1 #'# 1`%D #N F#F#6 ~# ~#A~#T~#Ja##,aclm#0 m#8sm#@m#H>;#Psrv#\ ~#` ~#d S#hS# #~#[#~#0#~#~##~#1~#qj# #P~# ~#* ##f~#m#^$T #id#m# ~# ~#K~#0#u0#T0#0# 1#1#0#P0#< 0##"0# 0#50##F#5F##5 ~#0# 0# 1#0#0#0#t0#0#0# 0#i# i#~#cap~#a#;a#g~#o#N# # #Hp#qp# ~# ~# ~# o~# ~# ~# Y# ^Y# d~# )~# g # , #  # a # [ # y  # B   #  ~#  # ~# ` # ~# o~# 0# v 0# # #HhB 0# 0#0#p7 ;4un5. in6aKp2u7h#  m#!b #srv"# <T"NI#6 J~# K~#fL~# M~#b N#O#`%Q#0R~# S~#$ S~#(#"T0#,6T0#0 U~#4 U~#8V~#<Wm#@X>#H;Za#L[a#\;]a#lg_~#|o`#b#7b#c# da#Lew#f~# g~#;g~#c!h~#z h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#vr0#Vr0#gsD#4 t#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~1#0#< 0#i# i#$~# ,u\v#t0w#t1w#5x#Ny#z~# {{~#$|~#(<#len0#pos0# sid0#srv#oe#src#buf #be u X0#:m# srv#G ~#6 ~#.Xact#bck#,Sact#bck#B ~#~#o ~#>~# ~#~#~#J #map# W #, .# N #e4N #5N #N #N #N B  ~#0~#5~#7~# <~# ~#+~#~#*   !( !D ~#x<#O <# <##Z#  #$3#P#(& P#,&P#0i#4 i#<-"pxƲ#svLj#Ew#w# L<0# iid~#~#sid~#D" ͘#"iid~#pxѲ#buf0#sid0# ptr~#bol~#" %˶! -" D" " "b "#b "!M#8+~{{U"si*Q#M#{{$^#P$i#R%u#qk~& j~'nowj~(#85{{U"si4R(#8C{|U"siBQ"msgB#S)#${1|$$R#$1|g|$$R# ( *$S.~'buf}" ($8T|2}U"siSS"msgS#Q)e$$||$$P)|$$||+$)$$||+%)$%|}$$%Q$/%P#;%|}$L%P+W%#c%}}+p%*$8'buf" *%%'buf" %;%!W~'nowV~&^$V~%c%9 L~'nowK~&^$K~*|%#'buf" ,"#%e,#%,%t%,%u~ %- ,&Q%,';0,(Q0,R(R0,(U0,r (V,(W(&D40Cvb@}9h J0?>x  "0:5 &i@\ 5intm 60 >E ?E AE3 C| D^?G6 S^ U  0BGQ8Fp*  D E#V F# *-{ *- K<+# -+ # + # + # +# y+# M+# 7 +# z+# +#$ g+#( +#, +h#0 +n#4 .+#8 +#< +#@ +">#D ` +#p#F +$t#G `+(#H +1#L +7#T 3+8#X S+:#\ +<#` 7  b+h) +M+h#+n# +#1{  *  3 T"3"4#"5#"6#"7# ~"8#"9#":#N!,!-#Q!.#!/#!0N#  $ >+   _# #   ! _# # #  wtm,w$x#y#gz#o{# 3|#G}#+~#_#v# #$#(2>o40Y  n#_#ۦ# ܼ## ,7 O bO# __ ,  M4# _# _# bit#u32"0A*F+e#key,# n #p #7 - #ref !#x D0wq1#rq2#6 3#04#45#8V 6#<7#@7Y4wl x$#y#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$uY#( i 7 '8$H6 $I0# $J0#J$K#fd$L# L<$M0#exp$N0#2$OI #2$PI #1$QI # 2$RI #$ib$S #(ob$S #, $T0#0$U#4C C i7  $SL<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8& #< 7#@7#AW#DHC #L& C #P #T #XO  P-tstru#lenv#      z##L##x ###\#fe##be#### L<##$ #0#(req# #,rep# #0si# #4i ##\"##k##srv#9##9# #9# # #txn##2 ##f### #E/# # #w##w##ז #@#0#  % #H%!#& %"#N%# #  ] )n!  _#! #  kO auid ^1#gid _#T `&#b bux a i Lfd M#6 N# O#; P#  QV#S R##" S# T0#N U\# V#>' Wr# X#^$ Yx# Z# [0#n bO #' c#V T Qu m~#2 n# o# p#h q_# rT#  s#$1 tr#(2 ur#,K v#0 w#4 x#8w y#<7 z#@4 {#H |#Lib rb  V,Cf,Ar#b,B #$ ,?cb,C$#J,D#6 ,E7#ev,F7#W ,G4#,HT# 4 j L#(##P# #: a^#_%#:`%#a!+N,!#+-'#Y.#s/# - [1 #'m#gg[(8len(90#cr(:0#N(;0# (Cv(D#0 (Ew#(Fw#P'(Gw#0(Hw# sN'YY  o.L   ' 'l'݉#m_l'މ#u'߉#u_l'߉# v'#v_l'#'l'#v_l'#c'#c_l'# r'#r_l'#$'rq'Yst'@' '0#sol'#eol'#som'0# col'0#sov'0#eoh'0#cap'N#sl'# < 'W#8Z'P0'N#'# ' #req'$#rsp'$#Xuri'#^ '#?'#9E'#L<'0#B 0# 0#0#9<THNI9#6 J# K#fL# M#b N#O#`%Q#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<W#@X#H;Z#L[#\;]#lg_#|o`#b9#7b9#c# d#Lew#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t#fu9#w0#w0# x0# y<#{0#{0#|0#t|0#}0#~Z#0#< 0#i# i#$#`%DQ\#N ##6 # #A#T#J#@"#,acl#0 #8s#@#H>;^"#Psrv9#\ #` #d ##hS# ##[##0#É#ĉ##Ɖ#1lj#q2# #Pʉ# ˉ#*$##fΉ##^$$#id## ܉# ܉#K݉#0#u0#T0#0# Z#Z#0#P0#< 0##"0# 0#50###5##5 #0# 0# <#0#0#0#t0#0#0# 0#i# i##cap##;#g#o#N# .!# .!#Hp#qp# # # # o# # # !# ^!# d# )# g %# , %#  # a # [ # y %# B  %#  #  # # `%# # o# 0# v 0# !# !#H?4 && #&! #srv&"9# D# ##x#G#O #G# #G###Z##  ##$3##P#(& #P#,&#P#0#i#4 #i#<# #px#Ƹ#sv#9#E#w##w# L<#0# iid#ʉ##ʉ#sid#ʉ#: ### #iid#Љ#px#Ѹ#buf#0#sid#0# ptr#ԉ#bol#Չ# # %#ˬ ## #: i      C   .!p7 ;4jun5 in6G!Kp2u7!#! ,u\v4#t0w4#t1w4#5x#Ny#z# {{#$|#(@"G#len0#pos0# sid0#srv9#oe#src#buf #^"be u" X0#:#" srv"#G #6 #9"XactG!#bckG!#,#act4#bck4####o #># ###J 9#map"# W"#, "# $#e4$#5$#$#$#$9#$ щ#0҉#5Ӊ#7ԉ# <Չ# ։#+׉#؉#$* n&# '#W(#.3)# L<*#-+&#,?&#N-$#$! % % /% e%2 1,1-#kw1.#15%#%Ne%%1=1>#kw1?%# %/%"& N&###%?&R N?&## #&&-Q-M#-N#-O# -P# '-;uid-<#gid-=#->##"-?# -@# -A#-B#(-C#T-D# -E#$-F#(-G#,%-H#0H-I#4q-I#8-J#<-J#@ -K.!#D -K.!#@-QE&# -Rb #a-S##*9<@}U$d;:N~$9: $B9:$!%;%err;$5;&[(0']>%'>%&)X(su? ~)@S*(#~P~']^%'^%+#~P~'H^)^P*(X~k~']b%'b%* )s~~']f%'f%*1)~~']q%'q%&H))r*P*)~']Z%'Z%+~'HZ)ZP,)*1-*.+1-+- +-,+/)g9+P*)u']%'%**']%'%&c*'#".*-*.+-+- +-,+,**-*.+-+- +-,+,*+-+- +-,+/)^$0~(resP 0+n1m09+ -1+1G+N1>,2w+19U%msgw+$0   3,9e IU4sd 4pxd 4urid$R5repf d5svg9`5svsg9V5msgh h&, 69T*,6s?&S7lent+ǁ؁8]%8%+ǁ؁8H6P&,p6H9*,U&,6H9},U&,6"t0P/6"0P , 3-u9GP[U4sF V4repF W4uriF$7pxH5msgI h5upJ0S,{--ݏߏ--,----.-2Q--9-G):buf ;-+9T:nSP2j.9`ŖU%s V%rep W%uri$U4s\ V4rep\  5msg^ ,.-en--*/8h&g/5pn89 ./ӗ-/-/./ӗݗ-0- 0,/0>(0P*/"7__v>*/˙ۙ7__v>/08hf;/$:now:exp;0qk? j:nowj;209[:tZ=1:!@MU4s  4rep   @"15msg# ANU&0H5esA1~,0---&'1h896m9~.1-1-1-1-1>1~/B1~B1Q&m15pnS15tmT. 2(>2~>&2P.-.5-- 1 !C1:Doutw+10 Derr11J+xDptr7end7c7 2 -E22Dnow22Dtm72 <F9PbUG,)K]2c2 >G)Lu2{2 ~GI)Mu2G"*2pG*2G,t2G,uG -Z 2H GQ2 3HG3 2@`%-G.;0Inow.GG-V&Ipid-XG-YG-\ G/G/G 0GQ0GRR0GS0GT0GU0Gr VGW46'%%U5GpP;h J0?>x  "0:5 &i@ 27\ 5intm 60 >E ?E AE3 C| D^?G6 S^ U  0 B G Q8F: >; 0* !D!E#V!F# )-/ )- K<*# -* # * # * # *# y*# M*# 7 *# z*# *#$ g*#( *#, *#0 *#4 .*#8 *#< *#@ *">#D ` *#p#F *$#G `*(#H *1#L *7$#T 3*8$#X S*:#\ *<#`5 7@ :$W c $ b*) *M*#*# *#jc3$>+ ##" Y!##Y#iw6 7# 8#)n!  #!#k 2>o 40Y  n#Z## #Z#j7 b#j  Mr# # # bit#u32"0!A*F+#key,#FnF#pF#!u - !#ref!F#x D0wq1#rq2#6 3#04#45#8V 6$#<7#@ u4 wl xK# y!# z0# M {0#% |0#p }0#0 ~0#L< 0# - 0#$u #( u '8"H6 "I0# "J0#J"K$#fd"L# L<"M0#exp"N0#2"O#2"P#1"Q# 2"R#$ib"S #(ob"S #, "T0#0"U$#4  u "SL<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8& #< 7#@7#AW#DH#L& #P #T #X P-tstru#lenv#       z!#L!#x #"#fe#be## L<#$ 0#(req #,rep #0si#4i "#\""#k#srv # #  # #txn#2 #f##E/# ‚#Â#g#@0#   ] auid ^<#gid _&#T `1#( bux a /  Lfd M#6 N# O#; P"#  Q#S R##" S# T0#N U"# V!#>' W8# X#^$ Y># Z$# [0#n b #' c# T Qu mD#2 n# o# p#h q# r#  s#$1 t8#(2 u8#,K vd#0 wd#4 xd#8w yd#<7 z!#@4 {#H |!#L/ ( 8 (Td T+Cf+A8#b+B # +?cb+C#J+D$#6 +E7#ev+F7#W +G#+H#j X L#(##P# !# a^$#_%#:`%#ai+N,#+-#Y.#s/:#  &1 F#'8# 2 2X&}%8len%90#cr%:0#N%;0# %Cv%D#0 %E#%F#P'%G#0%H# >$YY  o.L   ${$l$ݔ#m_l$ޔ#u$ߔ#u_l$ߔ# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$#$rq$$st${@$ $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڇ#sl$# < $W#8+$P0$#$}# $ #req$#rsp$#Xuri$#^ $#?$#9E$#L<$0#bB 0# 0#0# <THNI #6 J# K#fL# M#b N#O#`%Q#0R# S#$ S#(#"T0#,6T0#0 U#4 U#8V#<W!#@X#H;Z#L[#\;]#lg_#|o`#b #7b #c# d#Le#f# g#;g#c!h#z h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t#fu #w0#w0# x0# yG#{0#{0#|0#t|0#}0#~+#0#< 0#i# i#$#b`%DQ"#N ##6 # #A#T#J#%#,acl!#0 !#8s!#@!#H>;%#Psrv #\ #` #d F&#hS# ##[##0#Ô#Ĕ##Ɣ#1ǔ#q# #Pʔ# ˔#*'##fΔ#!#^$G'#id#!# ܔ# ܔ#Kݔ#0#u0#T0#0# +#+#0#P0#< 0##"0# 0#50###5##5 #0# 0# G#0#0#0#t0#0#0# 0#i# i##cap##;#g#o#N# n$# n$#Hp#qp# # # # o# # # # ^# d# )# g'# ,'#  c# a c# [ c# y '# B  '#  #  # # `'# # o# 0# v 0# %# %#Hr ## !##! #srv#" # }D #xh#O h# h##Z#  #$3#P#(& P#,&P#0i#4 i#<pxƉ#sv #EȂ#Ȃ# L<0# iidʔ#ʔ#sidʔ#  L#giidД#pxщ#buf0#sid0# ptrԔ#bolՔ# %}         . _#'dow'#h1'#m1'#h2' #m2'#u 'min'i#max'i##'˔#"'̔# ';'#c'# 'i'Ȕ '. e"'u c#' 'ptr'$str'reg' ^!S#,''!#val'Ӛ #ptr' ##'Q# len'ڔ#$L<'۔#(! 'p'$i'll'id'!a'! !$!"0'i'#ptr'#len'#L<'# ctx'^!#d""'kw':# '"# +#'## b>'2## '0# 4$' #~" E ~" > d""   $ " #"#>' '!!#kw'"##arg'%r## #'&# "''!#!"2# # ~"#c##' '!#kw'c##r#!!"#'%#str'$!$#acl'* '+!# u',# )?'-!# '.# '/0##F$A?'> '?!# "'@!#pol'A# 'B0# J+'C#n$p7 ;4un5in6$Kp2u7F$#% ,u\vr#t0wr#t1wr#5x#Ny#z# {{#$|#(%h#len0#pos0# sid0#srv #oe#src"#buf #%be u% X0#:!#% srv%#G #6 # !&Xact$#bck$#,F&actr#bckr#5'##o #># ###J  #map%# W%#, !&# A'#e4A'#5A'#A'#A'# A' 5'' є#0Ҕ#5Ӕ#7Ԕ# <Ք# ֔#+ה#ؔ#*' '' ' #4(2 -,--#kw-.:#-5](#](    4((-=->!#kw-?(#('!(/Q/M#/N#/O# /P# !*/;uid/<#gid/=#/>##"/?# /@# /A#/B#(/C#T/D# /E#$/F#(/G#,%/H#0H/I#4q/I#8/J#</J#@ /Kn$#D /Kn$#@/Q(# /R( #a/S#X*;&$&%!#@&&'#Y&'# *; =|; >#: ?R#%*`; F  G] ; HX* L< I]*F; Bop D]#v J*#&2,:np U'fdmV(L<mS(:m2,(!m2,);oX);pW*retqP);tTW++,__s~$+~ $~0 ~> ~7,__u~8,,__c~w-`Ƣ);*H);*.*__s$R, $0 > 7,__u>,,__cwv++&,n:U("V(` (5/;¤/:*fdS*errd*msg:`0,V`1,2,` T3fdS4:-:( tU5 'R6)"S7err*V8a-[::ѦU59"Q8-i;H1U5G"Q9.;g@U:sf V:reqf W6h.S61:ip;-.f}<.R<.Q=.7retR;*..1.;C..<.P;Z..bi1.0.z1.1 /0/z<&/P11/!*>.qk? j3nowj2.83buf 2.T&3buf >/!W3nowV?^$V>=/9 L3nowK?^$K414;ˬU5d;59 5B95!%:err557ptr:l7val0p6;Q+0̨@]%@%+*0Ԩ@]%@%=*1(6Yh6;d7polQ6@'S@.+0@]%@%+0"6@]%@%=1X@]%@%.x@H/6P-mw@]%@%;C117K< 2P;\11ժ< 2P=17acl #P6u:Q;11< 2P;11ʫ߫< 2P;11 < 2P;11>P1 2011 2>22:?`%142:+ЬU:px):l4) P:l7)$:dir)5)?*"5"*#R439:?U:px=:l4= P:l7=$:dir=5)?>"5">#6@p6;@V6;@R6A/S/;/ ;.6_Q6w6_l6:_h6:_d6:_`A:UB(L33 BI(M3B")3B)3B+t3B+u"4CB,Q4D`%-B-E0B.;0Enow.x "0:5&w@m60>S?SAS3C7|Dl?G6S7^ U7 0BGQ8Fe* %D%E#V%F#  n # p #e - e# ref !#R4$wl $xR#$ye#$z0# M ${0#%$|0#p$}0#0 $~0#L<$0# -$0#$u$X#( h  #N##u##X#># len# ># #!>#wA#"#h2Lo40Y  n#$L[+ '#[# k !'###  w'## ## E 0)n!  '#!0# @ k hp7 ;42un5in6Kp2 u7@# b#   M### bit>#u32 "08A *F +# key ,#x D 0 wq 1# rq 2#6 3>#0 4>#4 5#8V 6#< 7>#@8 a uid^&# gid_#T`#  buxaL fdM>#6 N>#O>#;Pk#  Q#SR>##"S>#T0#NU#Ve#>'W#X#^$Y#Z# [0#nb#'c# TQum##2n>#o>#p>#h q'# r# s>#$1t#(2u#,KvC#0wC#4xC#8wyC#<7ze#@4{>#H|e#L>>> 3 C>3*Q*M>#*N>#*O># *P>#  *; uid*<># gid*=>#*>>##"*?># *@># *A>#*B>#(*C>#T*D># *E>#$*F>#(*G#,%*H#0H*I>#4q*I>#8*J>#<*J>#@ *Kh#D *Kh#@*QI# *R#a*S># '8&H6 &I0# &J0#J&K# fd&L># L<&M0# exp&N0#2&O #2&P #1&Q # 2&R #$ ib&S #( ob&S #, &T0#0&U#4     &SL< }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4 >#8& #< E#@ E#A e#DH #L& #P 3#T 9#X . P- t str u# len v>#? ?  E    z e#L e#x # # fe # be # ># L< >#$ 0#( req #, rep #0 si $#4i k#\" k#k # srv # # # $# txn #2 >#f &## %#E/ $%# …# Å# $#@ 0#. 3 ' >#H'!>#& '">#N'#3#  J])8len)90#cr):0#N);0# )C v)D#0 )E#)F#P')G#0)H# J%(YY  o.L   (( l(># m_l(># u(># u_l(># v(># v_l(>#( l(># v_l(># c(># c_l(># r(># r_l(># (rq(0st(@( (0# sol(# eol(# som(0# col(0# sov(0# eoh(0# cap(ړ# sl(# < (e#87(P0(%#(# ( # req(# rsp(#X uri(#^ (#?(#9E(>#L<(0#= L#(#>#^# e#B !a!^#!_%#:!`%#!a# +N ,##+ -)#Y .>#s /7# /]1 #'o#ii] ,- ,-K<->#-- #- # - #  -#y-#M-#7 -#z-# -#$g-#(-#, -Q#0-W#4.->#8->#<-#@-"L#D` -#~#F-$]#G`-(m#H-1#L -7#T3-8#XS-:>#\-<s#`b-Q) -M-Q#-W# -># m   3+C f+A# b+B # +? cb+C#J+D#6 +EE# ev+FE#W +G#+H#  2 &`%D#N ##6 ># >#A>#T>#J# #, acle#0 e#8se#@e#H>; #P srv#\ >#` >#d !#hS# #>#[#>#0#>#>##>#1>#q4# #P># >#*###f>#e#^$ف"# id#e# ># >#K>#0#u0#T0#0# ##0#P0#< 0##"0# 0#50###5##5 >#0# 0# 1#0#0#0#t0#0#0# 0#w# w#># cap>##;#g>#o#N # h# h#H~#q~#>#># >#o>#>#># ##^##d>#)>#g#,# #a #[ #y ##B  ## ># #>#`##>#o>#0#v 0# < #< #HB 0# 0#0#   e#!? # srv"# <T"NI#6 J># K>#fL># M>#b N#O#`%Q #0R># S>#$ S>#(#"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;Z#L[#\;]#lg_>#|o`#b#7b#c# d#Le#f># g>#;g>#c!h>#z h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#vr0#Vr0#gs#4 t#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~#0#< 0#w# w#$># <  ,u\v# t0w# t1w#5x#Ny#z># {{>#$|>#( <# len0# pos0# sid0# srv# oe # srck# buf9# be  u X0#:e#0!  srv0!#G >#6 >#[!X act# bck#,! act# bck#o">#>#o >#>># >#>#>#J # map # W6!#, [!# {"#e4{"#5{"#{"#{"#{"o"" >#0>#5>#7># <># >#+>#># *" # &# #D  >#x <#O <#  <# 7#Z 7#  7#$3# ^#(& ^#,& ^#0 w#4  w#<N$ px # sv ǵ#E ȅ# ȅ# L< 0# iid ># ># sid >#e$  ͐#$ iid ># px # buf 0# sid 0# ptr ># bol ># $ % #  N$ e$ $  %? %$%?  %!_%< U"? V"S#-&</'U$s.? V%txn0-&p%fe1 l&23&R&.'23&S'%9&ޯ(J&)S&P*%ݰ%h[S+&,hi+&,ho-Ʊ%hUS.]&5F>/sF]&/pFh&c& n&&0<>0oU#&<pRU$s? V&/=eQR10'R<>`U$s? V$si S%req P%rep Q20'(B'(N'34Z'P5g'J^6tv1Ig'6tv2Ig'7retK^m'<1'<>ϷU$s? V$si W''' )(P((''9&(J&(S&29& 0(J&(S&.(9 L>/nowK>8^$K>!(<;зظU9s:? V9si: W:req< p:rep= S'(( ((((2(cj((((;(**/buf 80 >!X*'<dVU9sc? V9sic S' )0'/G(B'(N'34Z'P'I)0'(B'(N'304Z'P+)H<'5o>P2X*Ժ(e*2o*)|*Q(*')0'\u(B'(N'3x4Z'P')X*(e*2o*)|*R(*'*9&68(J&(S&'-*0'(B'(N'34Z'P'D** (*2*7(*;o*E,(/s';*#0/ctr/*/inc/0;*#!/ctr *!*><`ѽU9s? Q=/&0TU9t/:s1? Vp'M>&e>%P++?L<02/(/++,/( 0)0S'Z,/ ( 0(0'v,/0( 0(0',/(/',0(,0(70-4B0P',0=(,0(70-=4B0P'*-N0P(\0(f020')B'W(N'3( 4Z'P'A-r0KX(0'X-r04A(0'o-0ak(0*-?L<0'-0*4(0'-r0IK(0'-9&)J&S)S&P+-@ :len(>P'.0'(B'(N'-4Z'P'F.0  (020  (0'p.07(020(1'.17u(%12/1Au(@120AO)1P'.J1u(W1'.a1(n1'.x1)1P)1Q'/x1)1P)1Q'=/x1)1P)1Q'/a1(n1's/x1%<)1P)1W'/x1AX)1P)1W2x1d)1P)1W-U7len}>;/#/buf ;/U't/bufs .0 u>/t1t>/t2t>;N0%c/bufb 8/=b0,{%d0@r0i<6s? 6si ;0#&/buf ;0%/buf .0"/t.0 ~/t}.0} v/tu;1 ]8l \1./1/t.J1/t;a1/tƵ;x1%M/bL .1qk>8 j>/nowj>!1;`U9s? Q9si P< >P:err>S:fin>RA #%A*VA +w>A*\9A",=2uA,=2A+t]2A+u> 2B A.Qp2A;0Cnow<<A $Ay/#D (D )eA0>AQ0ARR0AU0Ar VAW1=INl<h d8len9d#cr:d#N;d#? CvD#0 E#F#P'G#0H# % 3<3lU len3 cr3 :W <3 e%V new3Q intkOp=h ?>x "%:5&^@intm6%>:?:A:3C|DS?G6S^ U % 9* DE#VF#^7 [JG[# k9 r=JDBGQ 3+   # #   ! # z# # " w( 23o4%Y- 8t nN#ڗ#C# Y## ,  -g - K<s# - #  #  # # y# M# 7 # z# #$ g#( #, #0 #4 .s#8 s#< #@ "3#D ` #e#F $#G `(#H 1#L 7#T 38#X S:s#\ <#`b) M## s#t  m  3 b#  `  M# # # bits#u32"%A*F+#key,`#n#p#,x D0wq1k#rq2k#6 3s#04s#45B#8V 6#<7s#@<<<,4wl xg#y#z%# M {%#%|%#p}%#0 ~%#L<%# -%#$u#(   '8H6 I%# J%#JK#fdLs# L<M%#expN%#2O#2P#1Q# 2R#$ibS #(obS #, T%#0U#4 SL< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& C #< ,#@ ,#A L#DH #L& #P O #T U #X7 7  =  & I f ] )n!  #! # k auid^#gid_v#T`# buxa  LfdMs#6 Ns#Os#;P#  Q #SRs##"Ss#T%#NU #V#>'W #XB#^$Y #Z# [%#nb #'c# TQum #2ns#os#ps#h q# r# ss#$1t #(2u #,Kv! #0w! #4x! #8wy! #<7z#@4{s#H|#L   ss s  ! s  H CfA #bB #  ?cbC #JD#6 E,#evF,#W G #H# '  1<]^#!=_ #set` #clra # =b # =c #remd #cloe #1f # 5g #$8>h #("i #,Cj #0uk"#4&ls#8 s s s      s   s    ;p7;4un5f in6tTKp2u7# QMs#Ns#Os# Ps# ;uids##"?s# @s# As#Bs#(Cs#TDs# Es#$Fs#(G#,%H#0HIs#4qIs#8Js#<Js#@ K;#D K;#@QT# R #aSs#&=&spUfd% Rdir%sQv 'PZp=+sUfd* Pdir*sRy=1sUfd0 Pdir0sR=7sUfd6 Rdir6sP!ret8sP 9P:=@s PUfd? Pdir?sR!retAsP"X BP#]>=IPtUfdHsP#m<RUpQ expQsR 9ESsS!fdTsW!iTsQ Uh g=Vsd =WsV G=WsS!fdsXs` Y_$m%~%$:%%&U P! P'qks( js)nowjs'$s)nows)exps=s Up V*=*=*=*]= (=sS#>T=<Up Se5=s@JUp #=PU!p R+"++8ps  +Sr+tH +us , + Q+;%+V+Q%+RR%+U%+r V]H+Wpk  k =v, =v4L;>QN>h J0?>x "0:5&i@\5intm60>E?EAE3C|D^?G6S^ U 0 #-& #-K<$#-$ #$ # $ #  $#y$#M$#7 $#z$# $#$g$#($#, $+#0$1#4.$#8$#<$#@$">#D` $#p#F$$7#G`$(G#H$1#L $7#T3$8#XS$:#\$<M#` 7    b$+) $ M$+# $1# $#&G]3 n #p #]  - ]#ref !#8F B G Q* D E# VF#2>o40Y M  n'#$>+  X# #  !X# # #w( X# #  2# (#87 [  b [#kk8  M @# k# k# bit #u32 "0A * F +q#key ,#\x D 0wq 1#rq 2# 6 3#0  4#4  5r#8 V 6#<  7#@ll l\4w l x# y]# z0# M {0# %|0# p}0# 0 ~0# L<0# -0#$ u#(!  '8H 6 I0# J0# JK#fdL# L<M0#expN0# 2O# 2P# 1Q# 2R#$ibSP #(obSP #, T0#0 U#4  !P S L<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 #8 &9 #< 7#@ 7#A W#D H#L & #P E #T K #X P-tstru#lenv#  P  9  z ]# L]# x l#  #fex#bex# # L<#$  0#(reqP #,repP #0si#4 i # \"# k#srv# # # #txn# 2 # f# # E/# w# w# V# @0# ? \ ] )n !  X# ! # k auid^#gid_# T`# buxa  LfdM# 6 N# O# ;P# Q # SR# #"S# T0# NU # V]# >'W # Xr# ^$Y # Z#  [0# nb # 'c# TQ um # 2n# o# p# h qX# rM# s#$ 1t #( 2u #, Kv#0 w#4 x#8 wy#< 7z]#@ 4{#H |]#L      >%Cf%A #b%BP # %?cb%C# J%D# 6 %E7#ev%F7# W %G# %HM#c  L# (# # P# ]#xJ a ^# _%# :`%#a+ N,# +-# Y.# s/# U J 1 # '#  #B  0# 0# 0#Kp7;4cun5\ in6dKp2u7## 8len 90#cr :0#N ;0# Cv D# 0 Ew#  Fw# P' Gw# 0 Hw# d?   Y Y    o . L   l݉#m_lމ#u߉#u_l߉# v#v_l#l#v_l#c#c_l# r#r_l#rqJst@ 0#sol#eol#som0# col0#sov0#eoh0#capڭ#sl# < W#8Q P0?# # V #req#rsp#Xuri# ^ # ?# 9E# L<0#<TH NI# 6 J# K# fL# M# b N# O# `%Qx# 0R# S#$ S#( #"T0#, 6T0#0 U#4 U#8 V#< W]#@ Xl#H ;Z#L [#\ ;]#l g_#| o`# b# 7b# c#  d# Lew# f# g# ;g# c!h# z h# h# i# j# Fk#idm# n0# n0# o0# p0# q0# vr0# Vr0# gs# 4 t~# fu# w0# w0# x0# y# {0# {0# |0# t|0# }0# ~# 0# < 0# i# i# $#Qx`%DQ  # N 2# 2# 6 # # A# T# J#  #,acl]#0 ]#8 s]#@ ]#H >; #Psrv#\  #` #d  ~!#h S# # # [# # 0# É# ĉ# # Ɖ# 1lj# qȫ# # Pʉ# ˉ# *"# # fΉ# ]# ^$"#id# ]# ܉# ܉# K݉# 0# u0# T0# 0# # # 0# P0# < 0# #"0# 0# 50# #2# 52# # 5 # 0# 0# # 0# 0# 0# t0# 0# 0# 0# i# i# #cap# # ;# g# o# Nx#  K#  K# Hp# qp### #o### #^#d#)#g ##, ## #a #[ #y ##B  ## # ##` ###o#0#v 0# : #: #H@   ]# ! #srv"# lD # x# O # # # Z# #$ 3#P#( & P#, &P#0 i#4 i#<pxx#sv# Ew# w# L<0# iidʉ# ʉ#sidʉ#  ͈#ViidЉ#pxx#buf0#sid0# ptrԉ#bolՉ#%l!    :  ,u \v@#t0w@#t1w@# 5x~# Ny~# z# {{#$ |#(  #len0#pos0# sid0#srv#oex#src#bufK # bexu  X0# :]#.! srv.!# G # 6 #Y!Xact#bck#,~!act@#bck@#m" # # o # ># # # # J #map # W4!#, Y!# y"# e4y"# 5y"# y"# y"# y" m""  щ# 0҉# 5Ӊ# 7ԉ# <Չ# ։# +׉# ؉#*" # # 0#V #A?!?]#"!@]#pol!A#!B0#J+!C#0##_#!dow!#h1!#m1!#h2! #m2!#4$!min!i#max!i##!ˉ#"!̉#Y$! ;!2# c!2#$!i!ȉ!#e"!4$c#!ҏ#$!ptr!str!reg!׶$J%S#,! !]#val!Y$#ptr!،$# #!# len!ډ#$ L<!ۉ#(T% !p!i!ll!id!T%a![% k%%"0!i!#ptr!#len!# L<!# ctx!%##&"!kw!#!C&#+#!&#b>!&# !0#4$! #=&  =& $#&r& x  r& &x&&>!!!]#kw!"G'#arg!%1'# #!&#"!']#k%I&& & =&&"'#!!]#kw!"'#1'%!"G'!%#str!$%$'acl!*!+]#u!,#)?!-]#  !.#!/0#'?!3!4]#acl!5'#neg!6# M'(W?!9!:]#X>!;]#%;(u#)?;(#K(&(?;U'px9x'l49  'l79'dir9()?:r&(":&P&!)8AF0U'pxDx'l4D  'l7D'dirD()?Er&("E&P&)>S0FU'pxQx'l4Q  'l7Q'dirQ()?Rr&("R&P))@_PZU(Y ^("A^=& (-^ )?*>f`jU'pxdx'l4d  'l7d'dird()?er&("e&)w*?lpwU("k&("Ak=& )*KAsU("r&S("Ar=&Q*O/t)+?U("&V("A=&P+>S,ret-A+}?S)^+@U("&S("A=&Q*O/)+o?uU("&P("A=&V*O/)%,YA@U("&S("A=& *O/ȉ.endW.cS/,p +ӉR-*Ӊ&,@@U("&W("A=&R(t(s+^>l+O/h.cW.endd.psV.plS/, 0 1 2 P3->U4"&P4"A=&R3Q-?'U4"&&P4"A&=&R3-*A-MU4",&4"A,=& 3-J?5PyU4"4&R4"A4=&Q5s6-R23+.?CU4Y BS4"AB=&W4-B 6lenD7R..?OU8ptrO3.h>V4U4Y UP4"AU=&V4-U 2+W$S2O/XP30?v@tU4Y uV4"Au=& 4-u 5iwiVW5jx0Q2P'x0p2hx0l5ptryS9/0]}%0}%-0H}2}P9/0]~%0~%-0H~2~P/0 0]%0%1 0H2P/_0 0]%0%1!0H2P-#;0]%0%-#;0H2P32?U4Y V4"A=& 4- 5iih5j0V2P'0d2h0`5ptrW9}10]%0%-0H2P910]%0%-0H2P/ 2!0]%0%10!0H2P/K2H!0]%0%1`!0H2P-^v0]%0%-^v0H2P32"> U4Y P4"A=&P4- :3@,U8kwl+3P&:@3Z@4U8kwl33P1x!0h533=>=' `U4u<W4<V5acl>'S-3B0]@%0@%33@JG'` U8kwI0K2>LP5kwlM3W7"4A^\U8pat]=&S;w4 Arr&`U4)?qr&W4P>4V?4>k@j6patl=&6tmpl=&35?r&}U4d;VA?A ?@AA52)?r&\2>G'X2"A=&S2-`2>W5argT/r5!6end0@-#5retR35>'U8acl'2)?r&S2 >r&V-0h3p6r@'U4d;V4A@WA?A=kA@_2A'R2>r&S2uV3(7@7'U4f?6W4A@6 A?^A=[A@Y2A9'R2>:r&S2u;V2<V-0]?%0?%37;?d#(U4@c#2;@e7W2@e7p28>f7P2gAf7S''38K@v#0U4d;u4A@u 8poluPA?A2@{A/>{5argx`5negxW2@yV2Az'\2>{7S2|@|7X2@}#T-0]%0%-0H2P39@tU4@#P8pxx 8l4 8l78dirA@*O2;@728>72)?r&S5acl'P2"A=&W2"k%2*@2@2=-BO6__s3%:>S'U4@R#P4>R0V2;@T7S28>U7R5aclV'PBv>uUC,"KE:K: >C"L]:c: ~CI"M]:C"#:C#:C%t:>C%u:DC&Q::: 0E=:@ :+>.&W ; ; (F?8; ;2K#h&XW=%TAh J0?int>x "0:5&w@m60>S?SAS3C7|Dl?G6S7^ U7 0BGQ8Fe* DE#VF# n# p#e - e# ref!#R4wl xR#ye#z0# M {0#%|0#p}0#0 ~0#L<0# -0#$uX#( h n 2Lo40Ys ~ n#$L+ ##  @!##@# P w#ۉ# ܟ## E  -C - K<># - #  #  # # y# M# 7 # z# #$ g#( #, #0 #4 .>#8 >#< #@ "L#D ` #~#F $#G `(#H 1#L 7#T 38#X S:>#\ <#`b) M## >#J  C  3   b #  6   M #  #  # bit >#u32 "0jA *F +# key ,6#x D 0 wq 1A# rq 2A#6 3>#0 4>#4 5#8V 6#< 7>#@j '8H6 I0# J0#JK# fdL># L<M0# expN0#2O#2P#1Q# 2R#$ ibS" #( obS" #, T0#0U#4" SL< }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4 >#8& #< E#@ E#A e#DH #L& #P  #T  #XQ P- t str u# len v>#b b " h    z e#L e#x # # fe J# be J# ># L< >#$ 0#( req " #, rep " #0 si R#4i #\" #k P# srv # # # b# txn N#2 >#f # t#E/ # …# Å# (#@ 0#Q  . ]W )n!  #!W # g k a uid^&# gid_#T`# buxag  L fdM>#6 N>#O>#;P #  Q #SR>##"S>#T0#NU #Ve#>'W #X#^$Y #Z# [0#nb #'c# TQum #2n>#o>#p>#h q# r# s>#$1t #(2u #,Kv #0w #4x #8wy #<7ze#@4{>#H|e#L   >> >  >  C fA # bB" #o ? cbCo#JD#6 EE# evFE#W G#H#  p7;4un5. in6PKp2 u7# L#(#>#^# e#] a^#_%#:`%#a*+N,#+-#Y.>#s/h# h ]1 #'#>"8len"90#cr":0#N";0# "C v"D#0 "E#"F#P'"G#0"H# !   Y Y    o . L   !<! l!># m_l!># u!># u_l!># v!># v_l!>#! l!># v_l!># c!># c_l!># r!># r_l!>#!rq!st!<H@! !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!H# sl!# < !e#8!P0!#!># !( # req!# rsp!#X uri!#^ !#?!#9E!>#L<!0##B 0# 0#0#<THNI#6 J># K>#fL># M>#b N#O#`%QJ#0R># S>#$ S>#(#"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;ZP#L[P#\;]P#lg_>#|o`#b#7b#c# dP#Le#f># g>#;g>#c!h>#z h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#vr0#Vr0#gsA#4 tP#fu#w0#w0# x0# y1#{0#{0#|0#t|0#}0#~#0#< 0#w# w#$>##J`%DQ #N ##6 ># >#A>#T>#JP# #, acle#0 e#8se#@e#H>; #P srv#\ >#` >#d W!#hS# #>#[#>#0#>#>##>#1>#qȾ# #P># >#*"##f>#e#^$X"# id#e# ># >#K>#0#u0#T0#0# ##0#P0#< 0##"0# 0#50###5##5 >#0# 0# 1#0#0#0#t0#0#0# 0#w# w#># cap>#P#;P#g>#o#NJ# # #H~#q~# ># ># ># o># ># ># # ^# d># )># g"# ,"#  $# a $# [ $# y "# B  "#  >#  # ># `"# ># o># 0# v 0#  #  #H   e# !b # srv "# >D  >#x <#O <#  <# 7#Z 7#  7#$3# ^#(& ^#,& ^#0 w#4  w#< px J# sv #E ȅ# ȅ# L< 0# iid ># ># sid >#  ͐#( iid ># px J# buf 0# sid 0# ptr ># bol >#R % > ε  b Vtb hb z   ,u\v# t0w# t1w#5xP#NyP#z># {{>#$|>#( <# len0# pos0# sid0# srv# oeJ# src # buf # beJu X0#:e#!  srv!#G >#6 >#2!X act# bck#,W! act# bck#F">#>#o >#>># >#>#>#J # map # W !#, 2!# R"#e4R"#5R"#R"#R"#R"F"" >#0>#5>#7># <># >#+>#>#*" " " #( !#pA$U"u"0 0V"L<0#wA$S#D$R#I(W$ 0%#AU#D$S&#'R#NV!#AU<U"wAT$S'retVP(=$Aj@tU"wAi$V#'kP#NkS!w$AU"wA$S)!$h($AU#D$S#M ^V#^W#|A>p*"$*$*$*t$*u> "%+ *#Q%#AeW'WAh ?>x :5&S@int3Cz|DH?G6Sz^ Uz %*  D E#V F# $ 36+   # 6# F  -Q - K<h# - #  #  # # y# M# 7 # z# #$ g#( #, "#0 (#4 .h#8 h#< o#@ "3#D ` #Z#F $.#G `(>#H 1#L 7#T 38#X S:h#\ <D#` b") M"#(# h#Q >  T 3" '8H6 I%# J%#JK# fdLh# L<M%# expN%#2O4#2P4#1Q4# 2R4#$ ibS#( obS#, T%#0U#4..T" SL< }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4 h#8& #< ,#@ ,#A A#DH .#L& .#P #T #X:  ]hhC fA# bB#_ ? cbC_#JD#6 E,# evF,#W Go#H# o  B %# %#%#B %UctrR\!%VB!%Qage"%P,6uAB %a%b%A:%6Uctr9S B9%V 9%\;%QB;%Rage<%P!,6SAX%@UctrWS BW%  W%\Y%QBY%RCZ%ageZ%Pcm,6"`F`tuh  Q :%!now <bXZUBh ?int>x :5@?G b#k y  M# # # bit3# B`U FW Z<!5R  +7 Tf +7 s T f +7 's @T!$fQs), vsCFsPS BFBFB%EB%B%BB bB DLB$BDtagO Jy3sB3$B*B tagO tB`UsubnewV ~jW!R&2 .sorCCP Z+ qs!Q TfR +7 ss_rBsubnew!Bx :5@?G b#k y  M# # # bit3# u32"% s32#3 ;A* F+#key,#oBo_U unewo .{ p"VlShTVYf0"&2ehP_P"?  NBo unewooldoGB%$BC6C x :5&S@2,int3C|DH?G %:3;% -w -K<s#- # #  #  #y#M#7 #z# #$g#(#, #0#4.s#8s#<z#@"3#D` #Z#F$#G`(#H1#L 7#T38#XS:s#\<#` b)  M# # s#~  w  3 $ 3&+   # &# 6 o4% 6g  nA#5 '8 H 6 I%# J%# J K# fd Ls# L< M%# exp N%# 2 OG# 2 PG# 1 QG# 2 RG#$ ib S#( ob S#, T%#0  U#4AAg5  S L< }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#, %#0  %#4  s#8 & #< ,#@  ,#A A#D H A#L & A#P  #T #XM  ]ss C f A# b B#r ? cb Cr# J D# 6 E,# ev F,# W G#  H#  ;= |;>L# :?#`;FG;HL<IF; B opD# vJ#PC"s0U;#hfd$sP0#__s&Su&$&%&3&,__u&__c&aK" t us  Q]|0oCh ?>x "%:5&^@intm6%>:?:A:3C|DS?G % 0}C"fd#s# D$l# gC%l#^7 RJ GR# b0 r=J;BGQ 3+   # #    ! #  z#  #  w 23o4%Y$ /k  nE# ڎ# :#  P# # ,  -^ -K<s#- # #  #  #y#M#7 #z# #$g#(#, #0#4.s#8s#<#@"3#D` #e#F$#G`(#H1#L 7#T38#XS:s#\<#`b)  M# # s#k  d  3 b#  W M### bits#u32"%A* F+ #key,W#n#p##x D0wq1b#rq2b# 6 3s#0 4s#4 59#8 V 6#< 7s#@333#4w l x^# y# z%# M {%# %|%# p}%# 0 ~%# L<%# -%#$ u#(   '8H 6 I%# J%# JK#fdLs# L<M%#expN%# 2O# 2P# 1Q# 2R#$ibS #(obS #, T%#0 U#4 S L<}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0  %#4 s#8 &: #< ,#@ ,#A L#D H#L & #P F #T L #X. .  4   @ ] ] )n !  # ! # k auid^#gid_m# T`x# buxa  LfdMs# 6 Ns# Os# ;P# Q # SRs# #"Ss# T%# NU # V# >'W # X9# ^$Y # Z#  [%# nb # 'c# TQ um # 2ns# os# ps# h q# r# ss#$ 1t #( 2u #, Kv #0 w #4 x #8 wy #< 7z#@ 4{s#H |#L   ss s   s  ? CfA #bB #  ?cbC # JD# 6 E,#evF,# W G # H#   1<] ^# !=_ #set` #clra # =b # =c #remd #cloe # 1f # 5g #$ 8>h#( "i #, Cj #0 uk#4 &ls#8 s s s      s   s    2p7;4un5] in6kKKp2u7 # Q Ms# Ns# Os# Ps# ;uids# #"?s# @s# As# Bs# (Cs# TDs# Es#$ Fs#( G#, %H#0 HIs#4 qIs#8 Js#< Js#@  K2#D  K2# @QK# R # aSs#=)s0TUfd( Rdir(sQ6O *PQp=.s`Ufd- Pdir-sRy=4sUfd3 Pdir3sR=:sUfd9 Rdir9sP!ret;sP <P1=CsUfdB PdirBsR!retDsP"H# EP#T>=L4UfdK P#m<U@kUpT expTs 9EVsp!fdWsS CWsl CXsS!fdsZsh ZsV!sr[sP!sw[sR!rn\%d!wn\%P$"m09%~%$>BE%%&U`# P P'qks( js)nowjs'$s)nows)exps=spUp V*=*=*C (=sS#3T= `Up SZ5=s`jUp #|=pU!p R+"++8ps  +Sr+t? +us , + Q+ ;%+V+Q%+RR%+U%+r VR?+Web {{ b =k@ D <_wfDh ?>x "%:5&^@intm6%>:?:A:3C|DS?G % BGQ 3O+   # O# _  ! # z# #  w 23o4%C;LY  n#H## #H# X,  -c - K<s# - #  #  # # y# M# 7 # z# #$ g#( #, :#0 @#4 .s#8 s#< #@ "3#D ` #e#F $F#G `(V#H 1#L 7#T 38#X S:s#\ <\#` b:) M:#@# s#c V  l 3 b#  l  Mt# # # bits#u32"%#A*F+#key,#HnH#pH##x D0wq1#rq2#6 3s#04s#45#8V 6#<7s#@Np4wl x#y##z%# M {%#%|%#p}%#0 ~%#L<%# -%#$up#(  N '8 H6 I%# J%#J K#fd Ls# L< M%#exp N%#2 O`#2 P`#1 Q`# 2 R`#$ib S#(ob S#, T%#0 U#4ZZN  SL< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& #< ,#@ ,#A L#DH Z#L& Z#P #T #Xf  ] )n!  #! # . ka auid^#gid_#T`#t buxa. { LfdMs#6 Ns#Os#;P_#  Qh #SRs##"Ss#T%#NUn #V##>'W #X#^$Y #Z# [%#nba #'c#h TQum #2ns#os#ps#h q# r# ss#$1t #(2u #,Kv #0w #4x #8wy #<7z##@4{s#H|##L{ t  sst s  sh   CfA #bB#6  ?cbC6 #JD#6 E,#evF,#W GF #H# F &+ 1<]^#!=_E #set`E #clraE # =bE # =cE #remdW #cloeW #1ft # 5g #$8>h #("i #,Cj #0uk#4&ls#8@ s@ s s+ W @ K n n sL ]  sn z  n   p7;4&un5in6 Kp2u7 #$QMs#Ns#Os# Ps# j;uids##"?s# @s# As#Bs#(Cs#TDs# Es#$Fs#(G#,%H#0HIs#4qIs#8Js#<Js#@ K #D K #@Q # Rt #aSs#>ptr:fd;su32<u64=C 7D8#>j#6D)D*%#fd+%#*C!s'U 0 !sS!!S_=Ts0RU"fdS@ Q"dirSs #=Df`EU$ofsg!&DhsQ!DisS!NisR%chgjsp%fdjsW& ' S(('(V) *3S+?ND"s,D"s-op"s-fd"s,C"?."/CPU"fd@ Q CsS%ptrRp=sU"fd@ p"dirs %ofsV!DS!CRBy=sHU"fd@ p"dirs %ofsV!DS!CR/r>=PU"fdsW%ofsüS/DU"fdsV%ptrӂP/u<U"pn "expsS.9Es%fdsd!sp!Csl0@uEq'S'Q(()Qq*W0\((&((+C#s,D#s,D#?,D#s,^$#s.#+qks, js-nowjs+$s-nows-exps1=sU2pn V3uD23XD43D63C83C;4(=sS5T=EU2pDn S15=^sU2p]n 6fd_sP1CosU2pnn 5'=~wU6pn R7"4X7478ps dL 7SrT7t~ 7us 8 7Q7;%7V$7Q%7RR%7U%7r V7W!D.sP!C/L!zD0IH!=:`T!D=?X!-D>s\%evC` s !CbWb Dh ?>x "%:5&^@intm6%>:?:A:3C|DS?G % BGQ 3O+   # O# _  ! # z# #  w 23o4%C;LY  n#H## #H# X,  -c - K<s# - #  #  # # y# M# 7 # z# #$ g#( #, :#0 @#4 .s#8 s#< #@ "3#D ` #e#F $F#G `(V#H 1#L 7#T 38#X S:s#\ <\#` b:) M:#@# s#c V  l 3 b#  l  Mt# # # bits#u32"%#A*F+#key,#HnH#pH##x D0wq1#rq2#6 3s#04s#45#8V 6#<7s#@Np4wl x#y##z%# M {%#%|%#p}%#0 ~%#L<%# -%#$up#(  N '8 H6 I%# J%#J K#fd Ls# L< M%#exp N%#2 O`#2 P`#1 Q`# 2 R`#$ib S#(ob S#, T%#0 U#4ZZN  SL< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& #< ,#@ ,#A L#DH Z#L& Z#P #T #Xf  ] )n!  #! # . ka auid^#gid_#T`#t buxa. { LfdMs#6 Ns#Os#;P_#  Qh #SRs##"Ss#T%#NUn #V##>'W #X#^$Y #Z# [%#nba #'c#h TQum #2ns#os#ps#h q# r# ss#$1t #(2u #,Kv #0w #4x #8wy #<7z##@4{s#H|##L{ t  sst s  sh   CfA #bB#6  ?cbC6 #JD#6 E,#evF,#W GF #H# F &+ 1<]^#!=_E #set`E #clraE # =bE # =cE #remdW #cloeW #1ft # 5g #$8>h #("i #,Cj #0uk#4&ls#8@ s@ s s+ W @ K n n sL ]  sn z  n   p7;4&un5in6 Kp2u7 #$QMs#Ns#Os# Ps# j;uids##"?s# @s# As#Bs#(Cs#TDs# Es#$Fs#(G#,%H#0HIs#4qIs#8Js#<Js#@ K #D K #@Q # Rt #aSs#>ptr:fd;su32<u64=C 7D8#>j#6Ee%#s1%#(CDsU0 DsS DS!KDU"fd@ S!{KEPU"fdsS#pos%V=sPU"fd@ P"dirsQ#retsPp=sU"fd@ S"dirs $E#i%P%Wy=ssU&fd@ S&dirs 'EI(i%R)|>=%U&fd$sS)D/U&fd.sS);<8U&p7n &exp7sp*)E9%*D:%*9E;sl(eo;sS(fd<sT*&D<sQ*=sh*D>sd*C?sW*!E@s`'D+;,LS-W-a-k./vS+,S,Q--0/\1#(esR+"--2- -3NDEs4DEs5opEs5fdEs4CE6E3CFs4DFs4DF4DFs4^$Fs6F3qks4 js5nowjs3!$s5nows5exps%y=)s  U&p(n S'DC ' EE 'CG 'CJ )T=T  U&pSn S%5=is  U&phn (fdjsP%Czs  U&pyn ) =  U(pn R7"-X7-78ps ]L 7SrM7tw 7us 8 7Q7;%7V$7Q%7RR%7U%7r V7W  Dst Ds| @Esx DSl Ejp% D -Ds#ev% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$.? : ; @ %.? : ; ' @ &: ; I ': ; I (.? : ;' @ ): ;I *4: ;I + U,: ;I -4: ;I .4: ;I/ U0111213.? : ;' I 4: ;I54: ;I61 7.: ; ' I 8: ; I9.: ; ' :: ; I;.: ;' @ <.? : ;@ =.? : ;' I@ >4: ; I? < ?!@4: ;I? < A4: ; I? < B4: ; I?  C4: ; I?  D4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I  : ; % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I %4: ; I & '4: ; I( : ; ) U*1+1,1- ..? : ;' I /: ;I0 : ;11 2.? : ;' I@ 3: ;I 4 U541 6.: ; ' I 7: ; I8: ;I 94: ;I :4: ;I ;4: ;I<41=.: ;' I >: ;I?4: ;I@ A4: ; I? < B4: ; I?  C4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' @ #: ; I $%4: ; I&4: ; I '1(1 ).: ;' *: ;I+.? : ; ' I@ ,4: ; I - .: ; I / U0 14: ;I 213.: ; ' I 4: ; I5.? : ;' @ 6: ;I 74: ;I 8194: ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' @ ": ; I #1$1%.: ; ' I &: ; I'.: ; ' (: ; I).? : ; ' I@ *: ; I + U,4: ; I -4: ; I .1/1 0 141 2.: ;' I 3: ;I44: ;I5.? : ; I@ 6 74: ; I84: ; I? < 9!:4: ; I? < ;4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; ' @ : ; I : ; I 4: ; I  4: ; I.? : ; I@ .? : ; @ 4: ; I.? : ; ' I@ 4: ; I !.? : ; I@ "4: ; I? < #4: ; I?  $!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I % &4: ; I ' U(4: ; I)4: ; I* +4: ; I? < ,4: ; I?  -!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$!I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I<4: ;I =.: ;@ >4: ;I?.: ; ' @1 A.: ;' I B: ;IC : ;D.? : ;' @ E4: ; I? < F!G4: ;I? < H4: ; I?  I4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I? < $!%4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.: ; ' @ ": ; I #1$1%1&.: ; ' I ': ; I(.: ; ' I@ )4: ; I *4: ; I + U,1 -: ; I.4: ; I/4: ; I0.: ;' @ 1: ;I 24: ;I 34: ;I 4.: ;' I@ 5 : ;6 U7 84: ;I94: ;I:.? : ;' I@ ; <.: ; ' =.? : ;I@ >41?41 @ A4: ; I? < B!C4: ; I? < D4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I $ %4: ; I&.? : ; I@ '.? : ; ' @ (4: ; I)4: ; I *1+1,1-1 ..: ; ' I /: ; I0: ; I 1 U24: ; I? < 3!44: ; I? < 54: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ;' @ ": ;I #.: ;' I@ $4: ;I %4: ;I &1'1( U)41*1+1 ,41 - 1..: ; ' I /: ; I04: ; I1: ; I24: ; I3 : ; 4.: ; ' 5.: ;' I 6: ;I7.? : ;' I@ 8: ;I 94: ;I: : ;; U< =4: ;I> ? @.? : ;' I A.: ;' @ B4: ; I? < C!D4: ; I? < E4: ; I % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( " : ;# : ;I$!I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F.: ;' @ G4: ; I? < H!I4: ; I? < J4: ;I?  K4: ; I?  L4: ; I M4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I < !.? : ; ' I@ ": ; I #: ; I $4: ; I %.: ;' I@ &: ;I '4: ;I (4: ;I ).? : ;' @ *4: ; I + : ;, U-1.1 /10 U141 2413 415.: ; ' I 6: ; I74: ; I84: ; I9: ; I:.? : ;' I@ ;4: ; I? < $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' I@ #4: ; I $1%41& U' U(41 )1*1+1 ,.: ; ' I -4: ; I. /: ; I0: ; I1.: ; ' 24: ; I34: ; I 4 5: ; I 6 7: ; I 8.? : ; ' @ 94: ; I? < :4: ; I?  ;!<4: ; I? < =4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I3.: ;' @ 4: ;I 54: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH I.: ;' I J : ;K4: ; IL.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #1$1 %.: ; ' I &: ; I': ; I(.? : ; ' @ )1*.: ; ' +1,4: ; I? < -!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!< "!I#.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?: ; I@4: ;I? < A : ;B41 C.: ;' I D: ;IE.: ;' F.: ;' @ G4: ; I? < H!I4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; < !.? : ;' @ ": ;I #.? : ; ' @ $: ; I %4: ; I &4: ; I '1(1)1 * + U,4: ; I- ..: ; ' I /: ; I0.? : ; I@ 1.? : ; ' I@ 213 U441 5.: ;' I 6: ;I74: ;I8: ; I9: ;I :4: ;I ;.: ; ' <4: ;I =.? : ;' I@ > : ;?4: ;I@.: ;' A4: ; I? < B!C4: ; I? < D4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $1%1& '.: ; ' I (: ; I): ; I* : ; +4: ; I? < ,!% : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #4: ; I $4: ; I%.? : ; @ & '4: ; I (.? : ; ' @ ) U*4: ; I? < +!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $1%1& U'.: ; ' I (: ; I): ; I* : ; +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I +1,1 -1. /41 0 1 U213.: ; ' I 4: ; I5: ; I64: ; I74: ; I? < 8!   src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdlib.htask.heb32tree.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hdd9,V # +9,VV9,VV9,V\Ve%9^a;dEI#jc =G9+V0co>l 9x3xA̎WVVVVUrVGr<:t q՜hȎWr ՠIdVH,KX|:f.ds*~ Ȃ~MGsuOf,9T9,9T{ c&9V*9V9*9Vk(9X9(9XzkkUTnU 9^DSsGI&d8H~c@999H cU"G2yG~c~+~93xG~c~+~9@c~+~9Ve9+~UVUrwUV~9 + wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrddWƸ~.7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae8U:V✀v-7;zGJ8dd,d+t<7e5=D-8Vz9W=scW)-b Ȏq9.ɯn=5=+nU  ;%urrVg ׀8Hdh  8rr0˪V-rsU s csU+rd5 ($V8:VXYXWW~ V^<d32R<RYU9U#rpq'1q~9xU gVU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hPHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.hGHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊh srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.hUd8,J:,1|8,YJJ:1n8,fe$f͓8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8,  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h7|t*:V*,:eU,I;,qGdT԰GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ:*J:8dede9 9W/%tGw;7eu+WHs~G*:5rU)t4 9t+0Vrhd*: 5/~:U@y9>l?rqd++rcHsVrxncre cƒ+,cV qw3W<ude ~+~+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.hd8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӑ5gd;6d*GnX<;)-a;,HVVW,t #z+fm;)-a;,HVVW,rc%#z+<`>jXr;)-a;,HVVW,t oc:8HY5hdnf%V;,sHzU c, ye,H srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hfd.hglobal.htime.huŪ~|<:;juŪ~<,;iG R<:;XRh@XRh9 tq9c">T:;)Wcfn:drwJ,S,Wuc(:pH rT#~9T(\x9#W2-4Ӡ:Ss:s;aH#;hEUdU 7Wŷ<8:iGcc9d(yP C srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h G GfU9aG@y+@ GVeuA%GdS;Td;tr*d,fwq>qQ=:`G,+hUzG?|G+ Gk+~U=zU9+h+zG?}Ge9+sY*GVobqdTdV,Wed8*+] 9~=zG9qxqz?G|98f99/cW7Q/9WԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+!od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h`,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:m2 src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cstddef.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h$q:r7XG U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV j src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h0d9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,9/ src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hgrp.hcfgparse.hacl.hstat.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@Us/L#*&TI* $:p: c7,:;`;V8db s+\qH st-fr.GJ##Ic|qՆ(*r=~qՆd~ՆxqI%*r=ov  GG GGNe70b9fb9ge@dcd(eZH7ddrGHg5g6<6Xae-bd,.d9#*:e8|#*~,8dzE99ycz9c,*:,d64cPd &9)-sI~Ixs %#*un+*z-$*:f6f7d,8d8:VHL wUbd.n9$*:,(}s 9*+,xr,H, GH#*&TI* $d v+zqI<-N,czdc#*W oqmIHzHxsrr$ cv+yrq G G GH tq, GH,~&dcWyH|tH#*^1&*t +tck+ rdHr  GN#* cy9=`V;=5fV7rd cw9 c8,sc s+9 q~cr9~&sU tU ciM圡Vqd9y+}\-dr8r1rIstx~-vd9~$# #r q-dde U:8;7:HxrI#*b,dVI#*b,dVcHxrHxrI#*b,dVH#*LbHxr HzrxqrdsI#*8,&WX*8,h&WrrI#*b,h&WWHjV5yHxrI#*dswrI#*b,h&W[b,h&WVrrI#*8,&WWHj5yHxr#*L=*llUclcl+9*,X~ 99rxqr H+=GpG=z9rvcq*8,v,$u,dsyqd *8,ldbeS<8dl@9c* -Yrv,"7rvn:Ảz9P8U~$e7`e)e b;+L'IIZbrp/L;~d GԜ:|N"Unq?F:drf(`0d9{YYUN  t+e~\ xUAzde*,v M, 7-=mf9 $%x9k w9 +,,: G5uRr\k+ 9d)edTd cH8, 'f6f_ee+'pdeaff`gd|9~d Gf#_U~WGeU$Ugq9 Xdaday *~9IIg8r8d_= csc~f8,=T98,=cWeGd~d~@y9g9g#hUR:dgGUgU}WfGfU9}Ws7fU1d.db+:@9:8,j srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeserver.cserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.hmemory.hbuffers.htime.hstdio.hlibio.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hq9;HfĜ9;X{  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includechecks.cproxy.htask.hqueue.hticks.hfd.hacl.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hqueue.hserver.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hfd.hstandard.htime.hglobal.h@r0q,qcc, as:;7ecs9 9s9GV9*+V9*+b9tG +t9+'<\:(I;7ecs9 9s9Gt9 tc c,0=5.6<6=7e cx9itn0t(@ 7;sEe,ptq, +18HFM 8faWdgK@y9vtn0t(@IpN:=1 9w9dtn0t+9If ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d o  srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hfd.hglobal.hstandard.htime.hsession.h@9:iEas,Sd=cc~'$#sv, G~,~qVUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zq<D%Vq 9t+ cK~HM1>yqNyj~0 q#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`G{:n+qIł|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcyqO92+N+4+L+1yN+6Gc9~zdH-,8: zcdH-,8:,pyY+~=qyqyqczqzqƜ x>9B9nf99c8V1c7sO197e9}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd   srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6:7/JU,k}qr:T:krRGI7-v::8e :rt:/V8:a:[r8k>rV%+8d~I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎W:vqe 9vUd ~+:b:;7:,`:b:;7:,iwUA+$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^!Gy+ %z_S9-9S+-9 9_ 9_ +_c+hq U6f_q Vi8rV8;8:8dqUA+l 4'4dpUdjnUY*Gcopcp95c,6rsƀd ӎ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrkmY*G~c+~++vGE +c7-UmqRd`c`Uq`9G`99H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrjlvq qm?z9iUiqFq:9q9 V;#:p+HZ,@y+@y9@ ;8pe7H=53x9<Tld28,.78;, wU5=g*Z}s 9s9: qV;V:jyc@yG Vd[<6/540l=e:8eaX++t+;7db 9t+ 9'xq 9z9dcc?d9d+9dqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5չ+=6< iz9r;7=5;<6ed6<,zyGd q9UdH;}Rqƀ qcdc cd cccdq %qc9qUqGp]dW);oV q%-r8    wG p9UdHdb:r pcdc cd cccdqH8:ib:Vd pcdc cc cdcqd8d8:;  :!9"#$pŜU@y9jn<<6mrssH9Uqn:*dvG} +9n+9,}GA;:6rrV|qbr:db*;7,b;7-T d~bK8bea,:}$::8:e7,8:dKӝ\ƀ pcdc cc cdcq~1{ X DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W8dV]c#`qPU  srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hfd.hstandard.htime.hglobal.hproto_http.htask.hKPAh cv9 9v+ Śft)rrc~f9ecn[*dd;m9+x~?z9.ԜhG:IGHdHw rtc + :8,H:8 9w+dp@(deU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95dVr8;lU6;HddH40P GǙfrrdpVsy92vU=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f|GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:Z9&9H8,8:^>:8:Up9t ;I7; 9 +t9 +w,V:=C/:0,=5)4 VH:T1:*ru8:8: 2:0Sq&$5=G9:TqvG<6ffJfrn?7sz+i{chczG?|G +d|~U=zG9+xqzG?G|+G}U?zcsժgrrvr}h+z?|G+e mc+I:::9q;:{U9h+z?GIb.c9Km++HG:bd*dH,8 c{c8dcz99H :8wthŪD9 d*dH,8{dsvȜ XwHVrgw+T}3Hw9{qhcz}U% *u-rss:4}4v9u;d*J.:pg5=,;+.%54*} WH Ẁ*)s*F I <D 1*J(~+dpell66;d*~}cG"G~:*w}{lis#/dK|+|Uq}';sdȓ97*}cq}B-G0zc?H+@4> +*ed Gd q:*}0+|9}}lish ϒ$izd Gzd G+UgIGԀ*V+*f++9qGHR:6<nsxw+cVqw9UwG `+ G*#O@U#'wAw=<GJe7bd&=< :b,Żs&67e,Ɯ:Vv9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dwwc+O>g= m <9,+ 9krI+w9qd  srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hfd.h standard.hcfgparse.htime.hglobal.h task.hp)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#,~qVUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#ӏ)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~q  9D}]u!GN4vpI:p 7-TIX  ū;7;6=b:8:b?|&8:8&:WW&|Ub,9UkU*A᠎|q8:8F:|8:8:8'|:*9d0(:p-V q=,::7VV Ursf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzcdH-,8:xdH-,8:,p{rdT:Vrsb~~q9z%W+e6} qxu{qJy=:LGr c}h9Ǝ8rd-H?:?zzGGr~bdrds{3r}dԀdŎe}H  9dy:*dcf)w>9B9 n f99b 8V1c7s O197e9cx+|dqY*GdUY*GhY*G_:qY*GdUY*GhY*j~HkH~Vkez?wqx6qq6|qc#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.hselect.hp%9::8:-J:8:-JG;#HII7;HI<b+:x usU 9 f *Zcry+@y+Ax+,8:G-zc1s>XLPYMX)T,T,4d8))pUrr2P>8dtXX RGx*srT:ddS-  `.Wgrtrrrrrrrrrp srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hstandard.h:9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.hcU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.hyqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.hselect.hpoll.h0(9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud*I:FjGf9j9 c8,*y98:)WWS;|;);YWl9fP>TfEt6XJX R Gz*srT:dƸdS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.h G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;Hrtzc?HXdpJp ~G,#_as@d-rrcw~qfG~q *G P>pdWJ6XX8VJ8YRGu*s[,GHWƸdzq439.*IV d8We c `.grtrrrrsrrru srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.hG,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9r*:7Wc Ӓ  W;S/; 7W,}9c}U7W=7N+՜|4&f9 q/R<bbc"LWVeVV@p+&:T}f9}9 T9`Gq+q>ae6XJ8YRGfGr,fq!rT:dơdl59.*IV d8We U `.grtrrrrsrrr| $ .$ .,7 %.  .$ .$ ! .$P .Hp .m.0..0.` p O..O.(.+... . ..@....X@f !......%.,5 .,l  .` ... "..L.!..-.$.M....B..&... ....f..| $P3 ,O .09  .8 W . .<v  .#.<.0g .| (p | ,(I 0.,(3 $.,( = .,(`= .,(U ".,(= .(@= (# ( 4(жC +.4( C +.4(pC +.4(C +.| , 8.0k .,`\ .$" .$' .0  .0  .| ,S (@/ ,p( . ,f .2 $PC $A , %.03 .$0' 0` .(  ' $) , 3 (`f ( (px ( | $P + .0P  b.0P  i.0P   .0P  C.0P ` 6.,P PN .<P K .%. ,.| @ .. '. .@p .. '. .,4 .,05 .,p5 .  a.. . . . . . . . ..  .].08  ,..| ,  .,t X.0P .0` N.$P 4.| (` (z $1 .(` 0 Z .0\ .(: ( = (`I (d $ w 0 0 4  .k. 0 .| ,m .0PJ .,p 8.4H #.<` .q. +.$@A .| , d.,`F .$8 0.$2  .| 00 j., K.,S .| 0T  .4T O.*. Tj  v.a..]. . ..  ...[. . .a.>. '.. .). >.$T .T ih  b.. 5..4.. .*.{..0.. 0.. ..  ..  .. ..0. K.g. .. ..  .. Z.M. .&. }.6. .*. .. J.5. .X. !.>. 7.. 0. . .. %.2. *.W. !.. .. .V. .. .. .g. {.X. v._. *.. +.. .7. p.'. <. . !.|. M.9. .. . . 5.. .. '.Y. <.. I.. '.. (.. *.2. *.i. c.;. '.m. #.. '.. <.i. <.i. <.m. '.U. '.e. '.. '.. '.. ?.B. '.. .. '.H. <.m. '.j. '.K. C.`. 0.+..o..o. A.N. J.\.  .. ..  .hT`  '...G . -.. .. .T`q Tq | q: qR | 4T@rj !.8. 0Tr 8.4T@s 7.`Ts E..D. Q.0.U.N.  .`Tu7 ..D. Q.0.-.S.,. XTwL ..D. \.?.6.  .TT y- ..D. \.'.6. LTPz ?... .[.<Tp|h W. -..T~ . .=.g.p.I..^.. .R... .. 8TF g..| (  $ (  . } 8 0 .:.8 _  ..,  .| 8"`` . ".t"  .8. H.. .C. ..0#..C. "ОJ " S ,"| ?.,"{ ?." $" .| #7 #* T#0 .... @.. .D#0Y a.Y. .B. T# <.5.... .0#pz ".l#J R........(..L#@  _...=..H# .%. ... ,# .,#0S .<# [..d.|#p5 .J. ...  . . ... )..t#g  .2. ... 3.l....  .$#  .| (@Q p(R  . K.........<(  ?...0(  {.0( .0(  =.0(: A.$( .| 4)9 ..0)@t  .0)c .0)0 /.()\ 8)  ^..4)+ . . 0) .$)E ()a () <)P  .n.3.X). 0.....2..D)  E.. .. 0) .() () D) .S.:./. 0)$ .8) . .8) R. ..0) .4)0 %. .<) . Z.. L)P b. .. 8..0)` Z.X)z .. .. L.. -.0)p I.X)Pt  .0. .&. .. .<) . .. L) [. n.. 5.3.0) U.<)0  E. &.*. )   G...Q. .. 9.M. . . .. .=. .|.g. $)z  ..I.. R./. J.X.3. ..f. .O. \.N. q.-.V.u. ..7. [.?.i. ... .5..q..]. p.%.. v.<).\  ..&.)p.D ,).o =.,)0/A  .()/Y ()/O ()00e )0: ,)0s 5.,)`1v 5.0)1 *. ,)2E ;.,)2? 5.0) 3_ -. ,)3E ;.,)3? 5.8)4 *. ^.,)4E ;.,)5? 5.()P5d $)5 .| (\75C D\706L M. {..H.,\78s I.T\79 .3. ...%.,\7? .D\7P@ U.1.H.Y.0\7C 1.$\7Dj '.0\7E  .| $t9G .<t9G) %..P.0t9IJ .$t9`J& .$t9JM ,t9J .| (:K :L :`MA (:Mr (:0Nn <:N0 ...0:OA $.0: Q x.0:Q u.(:S (:@T" L:pU  . .{.'.r.,:Xc %.,:pX .4:`Y . .D:Z $. .B.0.,:P\ .8:p]F  ..<:^ . 0..T:pa0 2..h.4.?.*.,:it O.,: k c.:l  .x. .g. @.. 1.=.&. L./. #.d. ..=.[.0:@s* <.:pu; 0:u0 .0:x 5.0:y 5.0:Pz 5.0:z 5.$:p{ .| `A{- `A{* ,`A{ .,`A| .| 0B@}  R.$B .B ) .O. ,.@..k.9.p1. ..G.`.U. ..PF. _. 0. ./. K.8. ...;._.(....P. LBP  ..`J.5. .<B`e 5..` .,BЖ9 .XB. ._. >.*. [.U. .XB@   .). s..0+..@.$BP .| <0Ep f. .S. L0E  O.F. v... 00E T .0EQ 0EQ 00E@[ m. h0E+ .. X.K. .9. =.[. .0EЬ+ (0E $0E6 .| ,\G { _.8\G ..$\G0? #.(\Gp 0\G`1 .0\G/  .0\Gз }.L\Gv .6.s..t.\G`q \Gt ....$.I."..*.U.Q..2.I. .s. .H. .$\G`p | (J | TJp$ TJ  TJ  $TJ5 $TJ 0 TJP$ 8TJ . .,TJ  .,TJL  .TJ@  TJP | L L0 L0 LP  L`  Lp ,Lc ,.4L *. +.,LX !.,Le &.0L [.0L@\ .$L .$L .(Lm LP) 0L=  .$L  .,Ld  .(L@4 (L. $L+ .L L 0L @ .0L` .,LL .0L`a <.<L .X..<Lc ./. .<L  .k. .<L !.. .0Lh +.0L0 .8L . .(L; $L .| 0R M.,RV $.8R\ .#. .,R@4 .,RQ  .<R .R.0D. | (TO (TF $T@S | (T (T` | 0U_ .0U`n .(U{ (UP (U | 8V .1. .| hV0$ hV`  hV  $hV5 $hV0 hV$ 0hV@+ .,hVp ".,hV @  .hV`  hVp | $ X'  X0" ( X` , XP? ( XU ( XX ( XPN ( XK 0 X ., X- H., X .$ X( ., X,  . . X | $Z' ,ZJ ,ZP ZP2 (Zt (Zc ,Z .$Z DZ2 ..6.F.,Z   K.,Z t  .$Z ( .,Z -  . .Z  totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalluniq_idlogfac1capture_namelen_locknext_fullminavailsrc/haproxy.c__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconndo_logre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_addcookie_strprev_ctrhash_listfailed_secualgo__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlennb_taskswmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqcurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdgraceHTTP_METH_OPTIONStot_usedurl_param_lendenied_resptracknextHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbnext_svidpool2_requrinow_msnbbeuri_len_limituri_dirs_depth1node_p__socklen_texpb__task_unlink_rqcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectnb_req_capHTTP_METH_DELETEcum_sessdata_stateHTTP_METH_PUTeb32_deletebeconn_maxniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_t_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addfbcktv_acceptHTTP_METH_HEAD/data/git/public/haproxy-1.3/branch/masterto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnprotocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyusagefastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrfe_maxspstimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_task__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitpx_id_markersfwlcs_nextdoubledown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tlogssrv_addrredispatchesrequest_counthandlerhttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basedisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headl_lingerloglev1loglev2mon_fail_cond_old_offsetuser_lenconn_retrieswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognamedowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freeshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authstats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_nameout_realmstats_add_scopestats_check_init_uri_authstats_set_realm__lenout_base64ulistnew_nameout_ubase64src/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_torigurl2ipout_errh_lengthhostenth_nameh_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstrl2llrcret_valomultidivstr2sastrlcpy2octetshextabstrl2icinvalid_domainchar__strl2uicunit_flagslimit_rescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_string__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writebuffer_maxdeltabuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlennbloggerslogfdunixmonthnametm_zoneget_log_levelget_log_facilitysend_loglogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzinit_tasktimerseb32_firstrqueuenb_tasks_curprocess_runnable_tasksmax_processedeb32_nextsrc/task.ceb_nexttick_is_lttick_is_expiredrqueue_tickseb_first__task_wakeupwake_expired_taskseb_walk_downrun_queue_cur__task_queue__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifset__tv_isgtmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollernbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_inithex2src/regex.c__resrm_sopmatchcheck_replace_stringregoff_told_dstregmatch_tchain_regexrm_eomatchesexp_replacehex1cfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listproxy_type_strst_sizeatoist_blksizepw_passwdcurproxyconfsectst_gidrangeproxy_reset_timeoutscfg_keywordnext_pxid__s1cfg_optsdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidacl_seenwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoscfgerrcfg_parse_globalinit_default_instancerportparsest_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkpw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4__statbufha_usererrnumsrv_downtimesrc/server.csrv_getinterpc_bcktick_addattemptstask_newprocess_chkfd_insertout_wakeuppc_endpendconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledsrv_was_pausedset_server_enabledstart_checksout_errorcheck_for_pendingset_server_upout_nowakeredistribute_pendingset_server_downmininterevent_srv_chk_revent_srv_chk_wlskerrsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrc/queue.cpendconn_get_next_sessprocess_srv_queueratioinit_pendconnsrv_dynamic_maxconnpendconn_addpendconn_freependconn_from_srvget_frt_addripv4out_fail_repacl_fetch_dstacl_fetch_dportout_fail_idxacl_testsalensrc/client.cmax_setbuffer_initpatternsacl_keywordout_fail_rspcapout_free_sessionmin_setfreeptrbufupdate_freq_ctrfetchout_closeout_fail_reqcapacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskladdracl_fetch_dconnmax_acceptacl_fetch_sportout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosemaintain_proxiestick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwarduxst_unbind_listenerserr_returnbuffer_check_timeoutsuxst_req_analyser_statsdestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_reqcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenersuxst_add_listenerbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxhttp_msg_oodhttp_msg_rpbefore_crdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdrbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookielocal_asessionpathlenquotedhttp_msg_rpline_eolacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverasession_tempstats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenret_ptrhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptrhttp_is_tokenauthenticatedhttp_find_header2http_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirecthttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spmaxlenHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionnext_hdracl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcodeacl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrhttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupappsession_refreshinitializedhtblelementses_msizeidlenappsession_initkey1key2appsess_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsconnect_serverstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_errprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queuemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treeold_statefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_rateget_server_ph_postfwlc_get_next_serversrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeupdate_backend_weightiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serversstream_int_report_errorsrc/stream_interface.cstream_int_retnclosestream_int_returnbuffer_abortstream_int_check_timeoutssection_typesv_statesrc/dumpstats.cultoaprint_csv_headercurpxsrv_hlt_ststats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_update_stream_intsess_set_term_flagssess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafter_do_poll__fd_cond_cfail_srevt__fd_is_setfd_set_bytes_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_set__fd_clrsrc/ev_select.cfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwendacl_match_domdefault_acl_listout_free_expracl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_stracl_match_subtmp_termcreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventold_evtepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevt__fd_cloopcodeepoll_fdfd_chgfd_flush_changesepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncespec_processednbspecfail_fd_listspec_idxspec_listfail_specswitch_stateloopinglast_skippedfd_statusfd_createdrelease_spec_entry01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01:\c^ h W  >     58;Cru~x{C^Lk"PSYx/C)-039039?CTV`r/2Q ?O5<W4DFMm<p$ "G^4v8ft\fGr8@@G   < }   4 & 7 < ? 16AV G1QToQq riQq3(6C6465 QT<o=o<o=oT P! ??A??88,-r,,+,((''e!E#% &&>& &&k&'&&tvcrmr(****+C68-f2,,,r,./O8800.../x34ZS[Y5ZWYYiXX$XNX <:<;;:z;=>; <|;;~ArDtDOCDFF%EgEDDE%EDDE%EGGII4HHLHLMMLLMjMLM"N|NjMMM"NO5PH]]Q>SPQIUjUSSS5WWSS d@dccbmcSS]^W$XSBUjU5WXWYYY)^^=`z`4_R_^^g[geuf^+_R__+_4_[ggfg_4`z``4`=`higAh`zad4eab4ee4bbc dmccUddeeiivllj>kijYlvl>kkkYlllmmp@pqnnmqnppn(o=op@ppcqcrXsssQsqqqqqqrsstw0y_{z{Syz`yqz_{zzt{φpCdži&Ȅ\{_|l|+V>~φpdžvnnVCni eflD  ! ?  JLO>jPF HReKY 'Refy: dg ` *v m m ^v d + .I  "   & }W r  d}   ! % v$+15qv~y~ $ +!%:` U v   $   _ e *`sV[n7OY|     "s""&$))))T***j0+-H0j0/ 0z//k..,,z// ,",,,//-V.//Y.k.-.//..../ 0191Z2m21/2232273J334(4;4 4}55:;}55;;5566::66=77::7$8x99O8x9O;;=::9:;';=::::???$@@@@@@@A$EKFM@FCF8E>FAdCF*GKFF@FCFE>F2BCKFF}NOccaadaaL`u`M_T_[\[[ZZY@kps{ ' - M ` 6   < U i ~ X b s y g)4J~!U^~h369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r !)V)V '_e'Kip+v#+>>5D,.%W\_'*.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges#(( 1HH$7 ll`?̊ @Go  To؎@c 8l PP u%p88{Зww\ J J <\J\dJdhJh0K04K4lL X s  Qe%LPUUr? e | +8$ ]80X ^EC I #F W P5&i ( ,(Hl̊ ؎P  8 З w wJ J\JdJhJ0K4KLX !"#$%& (/ >I/   J\JdJLX  P XJ!`J.J<dJHw >^/w XXN X5  O +6Yn;pY@JPO\OhOpYy]]]]]] 2 O@@ ] ' =^DF]QZc@rj tr @s s u7 wL  y- Pz p|h O S )ОJ 7| E{ U e s{P0 0Y   QTR   dQ&.\ 5p.D D.o S0/A a/Y q/O 00e 0: 0s `1v 2E 3E 4E 2? 3? 5? .P5d =UK ]a l z 1  3_ 4 5 06L   $()0U3x Cy WPz nz L `MA Mr 0Nn OA  Q @T" $pU >S KXc _pX {`Y Z p{ {U@} UU P "  V. Ь+ @  {pVV + h VTt T WT TW 6    p$ ,      5 0  P$ "  + 44  = L F @  O P \ XWb  q 0 0 W @\   L `a   W     # < 0$ @ `     5 0  $ " @+ 4 p = @ F `  O p / : HB LK PU W` ' 0" Tm ` ~ `  \ P? U X  PN K "  X4 - =  F ( , O   l p t x |` ' J  P P2 t c     ( " 2 ~    4   =  t F ( - O  9 H WO WU  e    v l " " < k  /  @H /|  8 D! T2 W> F |/ S | e ( x  \> \ @ 8 (F pO ]  \ |2 0 0 ?5t M8 Y8 f9 }/lL --lLv L! /|u /|u /v /v vF /w L  = "N0 2p DжC Vpu; bc xf h  K @]{* `O`(#: 1` 60  @d K(Wp5 h2 nXw H. G ; @  1 @ % 0 ?QZ kh z@\ Y\ ; @@` X` ` $JM ,/>hJG V]`` tv    {- t 05  ]0 S *G) :=KH[  sF ~ 8$0/7 7t 0 - wM' :_ F / XXd^j/}/PN ?  3 @  `e { ' v /DD7V5@kz   0 ( `p ` F TIP 3 w ?T1hK tq 5C  `    `f  pz   k  7p IP  Y@ky`O O X  p( pC 0 px 8s e #:5`I C;TIJ g+ s  : N@4 Z 3 1 P@ :k *@S ; K(V5hU x/@= qR / P0 z  _ ] 0? ` &76Q NP X`1 o  ~: 0 u0  `J& P ;Q # ;c I`q ]E k:  Z 0XX P :  :5` @3Q W]bBv\ X ih .  p A  `QP +З 2m @@/ IV Rc/u7 C  7]p it `   @*<) D@Rz ] jpa0 x@Q /  D= @4 P L X+ @ ]j+ w 4 p H  {  = `= P\  ! l  9  <! 4 B ^ U f . 0@ O0 / O ; @  |:) X  !` ! C 4! >!@[ R!J e!PJ t!TQ!@!!Hv6 ! ! W ! !. ","Ж9 2"@A >" H" `"0S k" "  "d "S ""L "]"Pt "  "3#@  +#:;#l J#8\#w b##s# |#q#` #5#` #`#c#:#$w $`X$X'$ 0$@t E${ Q$0 Z$;r$wv$b$3$@ $$=$0 $$ $q: %] %' %]'%@%Q N%^d% m%S%`n % % %@%X%(% %&+ &`\ (& ) 9&| N& `&PC m&} {&p/Q&0' & &p &P) &X&0 &4K&&&:'4 '   'p 5'c ?'I O'`q e'hw'@s* 'X'@A'u'Dj ':'X'E  (p5 (]+(Q >(A Q(]\(b(Xr(X|(<(\Q((p]F (8 (J ( (X(= ))])p 6)F)d)p l) {)w) )O )` );) )`F )" )# *j  *: /*P :*DO*:_*, g*/z** *g * *P*L*9 *]*:* +z &+4+D+@<M+]Y+m c+r+`` +3 +@+@f +P  +|n +* +9 + +=+XQ,з ,P3 ),P3,\ B,g Z,j,  |,<,$ ,C ,w, ,7,|u abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidshostnameoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerinit_default_instancedefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_val__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_raterecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registeracl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsfreq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.c__dso_handleenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzerrecalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0pcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1http_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroygetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlineeb32_inserttcp_splice_initfdcfg_cfgfiletrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0chunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icbuffer_replace2findserversess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifsetchmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaydisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuenb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0tcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_malloccfg_parse_listenwaitpid@@GLIBC_2.0acl_match_dirparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301pool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0acl_seena2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopinit_proto_httphttp_200_chunkstrncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requireregcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_token__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeropollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onesrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warninghttp_err_codes_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2recv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingpcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info